DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment twz and Kctd15

DIOPT Version :9

Sequence 1:NP_001246449.1 Gene:twz / 37456 FlyBaseID:FBgn0034636 Length:367 Species:Drosophila melanogaster
Sequence 2:NP_001102611.1 Gene:Kctd15 / 499129 RGDID:1583737 Length:283 Species:Rattus norvegicus


Alignment Length:281 Identity:132/281 - (46%)
Similarity:178/281 - (63%) Gaps:34/281 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly    92 PGAVAAAAAAVGGASSAGASSYLHGNHKPIT-----GIPCVAAASRYTAPVHIDVGGTIYTSSLE 151
            |...:..|....|.:..|..|.|.....|::     |||..|..::..|||||||||.:|||||.
  Rat     8 PSGSSLNAHGSSGTAEGGNMSRLSLTRSPVSPLAAQGIPLPAQLTKANAPVHIDVGGHMYTSSLA 72

  Fly   152 TLTKYPESKLAKLFNGQIPIVLDSLKQHYFIDRDGGMFRHILNFMRNSRLLIAEDFPDLELLLEE 216
            ||||||:|::::||||..|||||||||||||||||.:||:||:|:|.|:||:.:||.|..||.||
  Rat    73 TLTKYPDSRISRLFNGTEPIVLDSLKQHYFIDRDGEIFRYILSFLRTSKLLLPDDFKDFNLLYEE 137

  Fly   217 ARYYEVEPMIKQLESMRKDRVRNGNYLVAPPTPPARHIKTSPRTSASPECNYEVVALHISPDLGE 281
            ||||:::||:::||..::::.:.                   |.|.:.:|    :.:.::|||||
  Rat   138 ARYYQLQPMVRELERWQQEQEQR-------------------RRSRACDC----LVVRVTPDLGE 179

  Fly   282 RIMLSAERALLDELFPEASQATQSSRSGVSWNQGDWGQIIRFPLNGYCKLNSVQVLTRLLNAGFT 346
            ||.||.|:||::|:|||......:| ....||| |...:|||||||||:|||||||.||...||:
  Rat   180 RIALSGEKALIEEVFPETGDVMCNS-VNAGWNQ-DPTHVIRFPLNGYCRLNSVQVLERLFQRGFS 242

  Fly   347 IEASVGG----QQFSEYLLAR 363
            :.||.||    .|||||:|.|
  Rat   243 VAASCGGGVDSSQFSEYVLCR 263

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
twzNP_001246449.1 BTB_POZ_KCTD1-like 137..230 CDD:349670 62/92 (67%)
Kctd15NP_001102611.1 BTB_POZ_KCTD15 55..153 CDD:349696 66/97 (68%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C166350263
Domainoid 1 1.000 136 1.000 Domainoid score I4799
eggNOG 1 0.900 - - E1_KOG2723
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H11450
Inparanoid 1 1.050 239 1.000 Inparanoid score I3277
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D412532at33208
OrthoFinder 1 1.000 - - FOG0002897
OrthoInspector 1 1.000 - - otm45727
orthoMCL 1 0.900 - - OOG6_108738
Panther 1 1.100 - - LDO PTHR14499
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X1912
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
1413.760

Return to query results.
Submit another query.