DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment twz and kctd15a

DIOPT Version :9

Sequence 1:NP_001246449.1 Gene:twz / 37456 FlyBaseID:FBgn0034636 Length:367 Species:Drosophila melanogaster
Sequence 2:XP_005163108.1 Gene:kctd15a / 449991 ZFINID:ZDB-GENE-041010-105 Length:265 Species:Danio rerio


Alignment Length:269 Identity:132/269 - (49%)
Similarity:177/269 - (65%) Gaps:35/269 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly   105 ASSAGAS-SYLHGNHKPIT-----GIPCVAAASRYTAPVHIDVGGTIYTSSLETLTKYPESKLAK 163
            :|..|.| |.|.....|::     |||..|..::..|||||||||.:|||||.||||||:|::::
Zfish     2 SSKEGRSMSRLSLTRSPVSPLAAQGIPLPAQLTKSNAPVHIDVGGHMYTSSLATLTKYPDSRISR 66

  Fly   164 LFNGQIPIVLDSLKQHYFIDRDGGMFRHILNFMRNSRLLIAEDFPDLELLLEEARYYEVEPMIKQ 228
            ||||..|||||||||||||||||.:||:||:::|.|:||:.|||.:.:||.||||||::.||:|:
Zfish    67 LFNGTEPIVLDSLKQHYFIDRDGEIFRYILSYLRTSKLLLPEDFKEFQLLYEEARYYQLTPMVKE 131

  Fly   229 LESMRKDRVRNGNYLVAPPTPPARHIKTSPRTSASPECNYEVVALHISPDLGERIMLSAERALLD 293
            ||..:::|                    ..|.||.| |  |.:.:.::|||||||.:|.:::|::
Zfish   132 LERWKQER--------------------EQRRSAQP-C--ECLVVRVTPDLGERIAVSGDKSLIE 173

  Fly   294 ELFPEASQATQSSRSGVSWNQGDWGQIIRFPLNGYCKLNSVQVLTRLLNAGFTIEASVGG----Q 354
            |:|||......:| ....||| |...:|||||||||:|||||||.||...||::.||.||    .
Zfish   174 EIFPETGDVMCNS-VNAGWNQ-DPTHVIRFPLNGYCRLNSVQVLERLFQKGFSMVASCGGGVDSS 236

  Fly   355 QFSEYLLAR 363
            |||||:|:|
Zfish   237 QFSEYILSR 245

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
twzNP_001246449.1 BTB_POZ_KCTD1-like 137..230 CDD:349670 62/92 (67%)
kctd15aXP_005163108.1 BTB 40..135 CDD:197585 64/94 (68%)
BTB 40..127 CDD:295341 59/86 (69%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170591936
Domainoid 1 1.000 136 1.000 Domainoid score I4873
eggNOG 1 0.900 - - E1_KOG2723
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 235 1.000 Inparanoid score I3365
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D412532at33208
OrthoFinder 1 1.000 - - FOG0002897
OrthoInspector 1 1.000 - - otm24279
orthoMCL 1 0.900 - - OOG6_108738
Panther 1 1.100 - - O PTHR14499
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R5816
SonicParanoid 1 1.000 - - X1912
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
ZFIN 00.000 Not matched by this tool.
1413.790

Return to query results.
Submit another query.