DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment twz and kctd6b

DIOPT Version :9

Sequence 1:NP_001246449.1 Gene:twz / 37456 FlyBaseID:FBgn0034636 Length:367 Species:Drosophila melanogaster
Sequence 2:NP_001002329.1 Gene:kctd6b / 436601 ZFINID:ZDB-GENE-040718-14 Length:237 Species:Danio rerio


Alignment Length:237 Identity:74/237 - (31%)
Similarity:107/237 - (45%) Gaps:61/237 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly   132 RYTAPVHIDVGGTIYTSSLETLTKYPESKLAKLFNGQIPIVLDSLKQHYFIDRDGGMFRHILNFM 196
            |.|.||.::|||.:||:|:.||.:||:|.|..:|.|..|...|: :.:|||||||.:||:||||:
Zfish     9 RLTHPVTLNVGGHLYTTSISTLQRYPDSMLGAMFRGDFPTTRDA-QGNYFIDRDGTLFRYILNFL 72

  Fly   197 RNSRLLIAEDFPDLELLLEEARYYEVEPMIKQLESMRKDRVRNGNYLVAPPTPPARHIKTSPRTS 261
            |.|.|.:..||.:|:||.:||.:|::||:|:.|..               |.|            
Zfish    73 RTSELTLPVDFTELDLLRKEADFYQIEPLIQCLND---------------PKP------------ 110

  Fly   262 ASPECNYEVVALHISPDLGERIMLSAERALLDELFPEASQATQ--------SSRSGVSWNQGDWG 318
            ..|...:|.|           :.||:.|.|.....|.|...||        |...|:|.|...|.
Zfish   111 LYPLDTFEQV-----------VELSSTRKLSKYSNPVAVIITQLTITTKVHSLLEGISNNFTKWN 164

  Fly   319 Q--------IIRFPLNGYCKLNS-----VQVLTRLLNAGFTI 347
            :        .:.|.. |.|..:.     |.::..:...||||
Zfish   165 KHMMDTRDCQVSFTF-GPCDYHQEVSLRVHLMDYITKQGFTI 205

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
twzNP_001246449.1 BTB_POZ_KCTD1-like 137..230 CDD:349670 44/92 (48%)
kctd6bNP_001002329.1 BTB 14..104 CDD:197585 44/90 (49%)
BTB 14..102 CDD:295341 43/88 (49%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170591941
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG2723
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
43.740

Return to query results.
Submit another query.