DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment twz and CG9467

DIOPT Version :9

Sequence 1:NP_001246449.1 Gene:twz / 37456 FlyBaseID:FBgn0034636 Length:367 Species:Drosophila melanogaster
Sequence 2:NP_001369000.1 Gene:CG9467 / 41207 FlyBaseID:FBgn0037758 Length:787 Species:Drosophila melanogaster


Alignment Length:194 Identity:57/194 - (29%)
Similarity:90/194 - (46%) Gaps:48/194 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly   137 VHIDVGGTIYTSSLETLTKYPESKLAKLFNGQIPIVLDSLKQH--YFIDRDGGMFRHILNFMRNS 199
            |:::|||..:::|.:|||..|::....|.:|:|..:.|   :|  .|||||..:|..|||::|..
  Fly    13 VNLNVGGQRFSTSRQTLTWIPDTFFTALLSGRISSLRD---EHNAIFIDRDPTLFSIILNYLRTK 74

  Fly   200 RLLIAEDFPDLEL--LLEEARYYEVEPMIKQL-------ESMRKDRVRNGNYLVAPPTPPARHI- 254
            .:    |..:.|:  |..||.||.:.|:.|:|       .|...|.:..| :|.|||.|....: 
  Fly    75 DI----DIKNCEIRALRHEAEYYGITPLTKRLALCEDLNHSSCGDLLFYG-FLAAPPMPSNEAVA 134

  Fly   255 -----KTSPRTSASPECNYEVVALHISPDLGERIMLSAERALLDELFPEASQATQSSRSGVSWN 313
                 ::.|.||||        |:...|....|:             ||.|:::.|..|  ||:
  Fly   135 ATSVDESLPSTSAS--------AIGSRPGSMVRV-------------PEPSRSSHSRNS--SWD 175

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
twzNP_001246449.1 BTB_POZ_KCTD1-like 137..230 CDD:349670 34/103 (33%)
CG9467NP_001369000.1 BTB_POZ_KCTD3-like 10..95 CDD:349672 31/88 (35%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.