DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment twz and kctd15

DIOPT Version :9

Sequence 1:NP_001246449.1 Gene:twz / 37456 FlyBaseID:FBgn0034636 Length:367 Species:Drosophila melanogaster
Sequence 2:NP_989239.1 Gene:kctd15 / 394848 XenbaseID:XB-GENE-944069 Length:255 Species:Xenopus tropicalis


Alignment Length:245 Identity:126/245 - (51%)
Similarity:164/245 - (66%) Gaps:29/245 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly   123 GIPCVAAASRYTAPVHIDVGGTIYTSSLETLTKYPESKLAKLFNGQIPIVLDSLKQHYFIDRDGG 187
            |||..|..::..|||||||||.:|||||.||||||:|::::||||..|||||||||||||||||.
 Frog    18 GIPLPAQLTKSNAPVHIDVGGHMYTSSLATLTKYPDSRISRLFNGTEPIVLDSLKQHYFIDRDGE 82

  Fly   188 MFRHILNFMRNSRLLIAEDFPDLELLLEEARYYEVEPMIKQLESMRKDRVRNGNYLVAPPTPPAR 252
            :||:||:|:|.|:||:.|||.:..||.|||:||::.||:|:||..::|:...            :
 Frog    83 IFRYILSFLRTSKLLLPEDFKEFNLLYEEAKYYQLHPMVKELERWKQDKEHR------------K 135

  Fly   253 HIKTSPRTSASPECNYEVVALHISPDLGERIMLSAERALLDELFPEASQATQSSRSGVSWNQGDW 317
            |.:         .|:..||  .::|||||||.||.|:||::|:|||......:| ....||| |.
 Frog   136 HFQ---------PCDCLVV--RVTPDLGERIALSGEKALIEEIFPETGDVMCNS-VNAGWNQ-DP 187

  Fly   318 GQIIRFPLNGYCKLNSVQVLTRLLNAGFTIEASVGG----QQFSEYLLAR 363
            ..:|||||||||:|||||||.|:...||.:.||.||    .|||||:|.|
 Frog   188 THVIRFPLNGYCRLNSVQVLERMFQKGFHVAASCGGGVDSSQFSEYVLCR 237

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
twzNP_001246449.1 BTB_POZ_KCTD1-like 137..230 CDD:349670 62/92 (67%)
kctd15NP_989239.1 BTB_POZ_KCTD15 29..127 CDD:349696 66/97 (68%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 135 1.000 Domainoid score I4933
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H11450
Inparanoid 1 1.050 233 1.000 Inparanoid score I3338
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D412532at33208
OrthoFinder 1 1.000 - - FOG0002897
OrthoInspector 1 1.000 - - otm48821
Panther 1 1.100 - - LDO PTHR14499
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R5816
SonicParanoid 1 1.000 - - X1912
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
1111.100

Return to query results.
Submit another query.