DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment twz and kcnrg

DIOPT Version :9

Sequence 1:NP_001246449.1 Gene:twz / 37456 FlyBaseID:FBgn0034636 Length:367 Species:Drosophila melanogaster
Sequence 2:NP_988863.1 Gene:kcnrg / 394457 XenbaseID:XB-GENE-987331 Length:280 Species:Xenopus tropicalis


Alignment Length:106 Identity:35/106 - (33%)
Similarity:65/106 - (61%) Gaps:9/106 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly   137 VHIDVGGTIYTSSLETLTKYPESKLAKLFNG---QIPIVLDSLKQHYFIDRDGGMFRHILNFMRN 198
            |.::|||..:::...||.::|:|:||::.:.   :|.|:    ..||||||||.:|.:||:::|.
 Frog     7 VTLNVGGMKFSTLSATLRRFPDSRLARMLDNADREIRII----NGHYFIDRDGSLFSYILDYVRT 67

  Fly   199 SRLLIAEDFPDLELLLEEARYYEVEPMIKQL--ESMRKDRV 237
            |:|.:...|.:.|.|..||.:|::..:...|  :::.:.||
 Frog    68 SQLSLPSGFSEFERLQREAEFYQLLSLADLLSQDTLYRPRV 108

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
twzNP_001246449.1 BTB_POZ_KCTD1-like 137..230 CDD:349670 33/97 (34%)
kcnrgNP_988863.1 BTB 7..97 CDD:197585 32/93 (34%)
BTB 7..95 CDD:295341 32/91 (35%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 257..280
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.