DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment twz and Kctd16

DIOPT Version :9

Sequence 1:NP_001246449.1 Gene:twz / 37456 FlyBaseID:FBgn0034636 Length:367 Species:Drosophila melanogaster
Sequence 2:NP_001357968.1 Gene:Kctd16 / 383348 MGIID:1914659 Length:427 Species:Mus musculus


Alignment Length:281 Identity:62/281 - (22%)
Similarity:116/281 - (41%) Gaps:65/281 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly   128 AAASRYTAPVHIDVGGTIYTSSLETLTKYPESKLAKLFNGQIPIVLDSLKQ---HYFIDRDGGMF 189
            |..:.:...:.::|||.:|.:...||...|.|.|.|:|:.:.....|..|.   .:||||||.:|
Mouse    18 AVPNSFPEVIELNVGGQVYFTRHSTLISIPHSLLWKMFSPKRDTANDLAKDSKGRFFIDRDGFLF 82

  Fly   190 RHILNFMRNSRLLIAEDFPDLELLLEEARYYEVEPMIKQL--ESMR-----------KDRVRNGN 241
            |:||:::|:.::::.:.||:...|..||.|:::..::|.|  |.::           :|..:..:
Mouse    83 RYILDYLRDRQVVLPDHFPERGRLKREAEYFQLPDLVKLLAPEDVKQSPDEFCHSDFEDASQGSD 147

  Fly   242 YLVAPPTPPARHIKTSPRTSASPECNYEVVALHISPDLGE------------RIMLSAERALLDE 294
            ..:.||:....|.:         :..:..|....|..||.            ||::....:|..|
Mouse   148 TRICPPSSLLPHDR---------KWGFITVGYRGSCTLGREGQADAKFRRVPRILVCGRISLAKE 203

  Fly   295 LFPEA-SQATQSSRSGVSWNQGDWGQIIRFPLNGYCKLNSVQ-VLTRLLNAGF-------TIEAS 350
            :|.|. :::....|:...:..       ||    |.|...:: ....|...||       ::.||
Mouse   204 VFGETLNESRDPDRAPERYTS-------RF----YLKFKHLERAFDMLSECGFHMVACNSSVTAS 257

  Fly   351 VGGQ--------QFSEYLLAR 363
            ...|        .::||:..|
Mouse   258 FVNQYTEDKIWSSYTEYVFYR 278

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
twzNP_001246449.1 BTB_POZ_KCTD1-like 137..230 CDD:349670 32/97 (33%)
Kctd16NP_001357968.1 BTB_POZ_KCTD16 23..125 CDD:349706 32/101 (32%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C167846742
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG2723
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.740

Return to query results.
Submit another query.