DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment twz and CG10465

DIOPT Version :9

Sequence 1:NP_001246449.1 Gene:twz / 37456 FlyBaseID:FBgn0034636 Length:367 Species:Drosophila melanogaster
Sequence 2:NP_610165.1 Gene:CG10465 / 35488 FlyBaseID:FBgn0033017 Length:301 Species:Drosophila melanogaster


Alignment Length:289 Identity:67/289 - (23%)
Similarity:114/289 - (39%) Gaps:98/289 - (33%)


- Green bases have known domain annotations that are detailed below.


  Fly   111 SSYLHGNHKPITGIPCVAAASRYTAPVHIDVGGTIYTSSLETLTKYPESKLAKLFNGQIPIVLDS 175
            |..:.|:||    |.....:|:|   :.::|||.:|.:::.||||..::.|:.:|:|::.::.||
  Fly     2 SESMSGDHK----ILLKGHSSQY---LKLNVGGHLYYTTIGTLTKNNDTMLSAMFSGRMEVLTDS 59

  Fly   176 LKQHYFIDRDGGMFRHILNFMRNSRLLIAEDFPDLELLLEEARYY-----------------EVE 223
             :....|||.|..|..|||::|:..:.:.|...::..||.||:||                 |.:
  Fly    60 -EGWILIDRCGNHFGIILNYLRDGTVPLPETNKEIAELLAEAKYYCITELAISCERALYAHQEPK 123

  Fly   224 PM--IKQLESMRKDRVRNGNYLVAPPTPPA------RHIKTSPRTSASPECNYEVVAL--HISPD 278
            |:  |..:.|.:::::     |::....||      |.......||.|.:...:.:.|  .:|..
  Fly   124 PICRIPLITSQKEEQL-----LLSVSLKPAVILVVQRQNNKYSYTSTSDDNLLKNIELFDKLSLR 183

  Fly   279 LGERIML--------------------------------SAERALLDELFPEA------------ 299
            ..|||:.                                :.:|......||||            
  Fly   184 FNERILFIKDVIGPSEICCWSFYGHGKKVAEVCCTSIVYATDRKHTKVEFPEARIYEETLQVLLY 248

  Fly   300 ----------SQATQSSR----SGVSWNQ 314
                      .|||.|:|    ||.|.||
  Fly   249 ENRNAPDQELMQATSSARVGSASGTSINQ 277

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
twzNP_001246449.1 BTB_POZ_KCTD1-like 137..230 CDD:349670 32/111 (29%)
CG10465NP_610165.1 BTB 20..117 CDD:197585 30/100 (30%)
BTB_2 21..112 CDD:280393 29/91 (32%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.