DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment twz and Kcnrg

DIOPT Version :9

Sequence 1:NP_001246449.1 Gene:twz / 37456 FlyBaseID:FBgn0034636 Length:367 Species:Drosophila melanogaster
Sequence 2:NP_001178616.1 Gene:Kcnrg / 305947 RGDID:1307199 Length:268 Species:Rattus norvegicus


Alignment Length:264 Identity:70/264 - (26%)
Similarity:106/264 - (40%) Gaps:62/264 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly   137 VHIDVGGTIYTSSLETLTKYPESKLA----------KLFNGQIPIVLDSLKQHYFIDRDGGMFRH 191
            |.::|||.|:|:.|.||.::|.|:||          |..||||           |:||||.:|..
  Rat     7 VTLNVGGKIFTTRLSTLKQFPASRLAGMLDGRDQEFKTVNGQI-----------FVDRDGALFSF 60

  Fly   192 ILNFMRNSRLLIAEDFPDLELLLEEARYYEVEPMIKQL------ESMRKDRVRNGNYLVAPPTPP 250
            ||:|:||..||:..||.|...|..||.:||::.::..|      ....:..|...::|       
  Rat    61 ILDFLRNHELLLPSDFSDHLRLQREALFYELDSLVDLLNQYLLQSGSARSAVMEVHFL------- 118

  Fly   251 ARHIKTSPRTSASPECNYEVVALHI-----------SPDLGERIMLSAER-ALLDELFPEASQAT 303
            .|:.:...|...|.....|::...|           |.....::.|..:| :..|.||...|...
  Rat   119 NRNTQAFFRVFCSCSKTIEMLTRRITMFVEQPTALASDSNSPQVALPPQRPSHHDLLFHCGSDGA 183

  Fly   304 QSSRSGVSWNQGDWGQIIRFPLNGYCKLNSVQVL----TRLLNAGFTI---EASVGGQQFSEYLL 361
            ..:.:||.:        |....:.....|...||    ..||..||.:   .|...|.: |||.:
  Rat   184 TENHAGVRY--------ISIKPDNRKLANGTNVLGLLIDTLLKEGFRLVSTRAPASGDK-SEYYV 239

  Fly   362 ARRV 365
            ..|:
  Rat   240 FERI 243

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
twzNP_001246449.1 BTB_POZ_KCTD1-like 137..230 CDD:349670 40/108 (37%)
KcnrgNP_001178616.1 BTB_POZ 5..101 CDD:365784 40/104 (38%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C166350266
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG2723
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
43.740

Return to query results.
Submit another query.