DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment twz and Kctd6

DIOPT Version :9

Sequence 1:NP_001246449.1 Gene:twz / 37456 FlyBaseID:FBgn0034636 Length:367 Species:Drosophila melanogaster
Sequence 2:NP_001100723.1 Gene:Kctd6 / 305792 RGDID:1308208 Length:237 Species:Rattus norvegicus


Alignment Length:237 Identity:73/237 - (30%)
Similarity:104/237 - (43%) Gaps:65/237 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly   134 TAPVHIDVGGTIYTSSLETLTKYPESKLAKLFNGQIPIVLDSLKQHYFIDRDGGMFRHILNFMRN 198
            |.||.::|||.:||:||.|||:||:|.|..:|.|..|...|. :.:|||||||.:||::|||:|.
  Rat    11 TDPVTLNVGGHLYTTSLTTLTRYPDSMLGAMFGGDFPTARDP-QGNYFIDRDGPLFRYVLNFLRT 74

  Fly   199 SRLLIAEDFPDLELLLEEARYYEVEPMIKQLESMRKDRVRNGNYLVAPPTPPARHIKTSPRTSAS 263
            |.|.:..||.:.:||.:||.:|::||:|:.|..               |.|              
  Rat    75 SELTLPLDFKEFDLLRKEADFYQIEPLIQCLND---------------PKP-------------- 110

  Fly   264 PECNYEVVALHISPDLGERIMLSAERALLDELFPEASQATQ--------SSRSGVS-----WNQ- 314
                     |:......|.:.||:.|.|.....|.|...||        |...|:|     ||: 
  Rat   111 ---------LYPMDTFEEVVELSSTRKLSKYSNPVAVIITQLTITTKVHSLLEGISNYFTKWNKH 166

  Fly   315 ----GDWGQIIRFPLNGYCKLNS-----VQVLTRLLNAGFTI 347
                .|......|   |.|..:.     |.::..:...||||
  Rat   167 MMDTRDCQVSFTF---GPCDYHQEVSLRVHLMEYITKQGFTI 205

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
twzNP_001246449.1 BTB_POZ_KCTD1-like 137..230 CDD:349670 44/92 (48%)
Kctd6NP_001100723.1 BTB_POZ_KCTD6 10..113 CDD:349702 50/140 (36%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C166350269
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG2723
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
43.740

Return to query results.
Submit another query.