DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment twz and Kctd19

DIOPT Version :9

Sequence 1:NP_001246449.1 Gene:twz / 37456 FlyBaseID:FBgn0034636 Length:367 Species:Drosophila melanogaster
Sequence 2:XP_008770780.2 Gene:Kctd19 / 291965 RGDID:1561326 Length:939 Species:Rattus norvegicus


Alignment Length:401 Identity:85/401 - (21%)
Similarity:133/401 - (33%) Gaps:134/401 - (33%)


- Green bases have known domain annotations that are detailed below.


  Fly    35 ERDVKALEPRDLSSTGRIYARSDIKISSSPTVSPTISNSSSPTPTPPAS----------SSVTP- 88
            |.:|:.||..:|:...|:| |.:|             ..||.|..||.|          .||.| 
  Rat   248 EAEVEILEIPELTEAVRLY-RMNI-------------GGSSRTSCPPLSPGKGGRIASLESVKPL 298

  Fly    89 ----LGLPGAVAAAAAAVG----GASSAGASSYLHGN---------------------------- 117
                |||  .|....:|:|    .::..|:..|:.||                            
  Rat   299 YMMALGL--LVKYPDSALGQLRIESTLDGSRLYITGNGVLFQHVRNWLGTCRLPLTETISEVYEL 361

  Fly   118 -----HKPITGIPCVAAASRYTAP-------------------------VHIDVGGTIYTSSLET 152
                 .:.||..|...|...:..|                         :.:.||...|.::|:|
  Rat   362 CAFLDKRDITYEPMKVALKTHLEPRTLPPMDMLNEEWTAEVTIYSPQQIIKVYVGSHWYATTLQT 426

  Fly   153 LTKYPESKLAKLFNGQIPIVLDSLKQHYFIDRDGGMFRHILNFMRNSRLLIAEDFPDLELLLEEA 217
            |.||||     |.:....:...:..|...|..||.||||||||:|..:|.:..:|.:..|..:|.
  Rat   427 LMKYPE-----LLSNTQRVYWITYGQTLLIHGDGQMFRHILNFLRLGKLFLPSEFKEWPLFCQEV 486

  Fly   218 RYYEVEPMIKQLESMRKDRVRNGNYLVAPPTPPARHIKTSPRTSASPECNYEVVALH-ISPDLGE 281
            ..|.:..:.:.|...  |..::.               |..:.|.:.|. :.:..|| ::...|.
  Rat   487 EEYHIPALSEALAQC--DAYKSW---------------TQEKESENEEA-FPIRKLHVVTEGTGP 533

  Fly   282 RIMLSAE----RALLDELFPEASQATQSSRSGVSWNQGDWGQIIRFPLNGYCKLNSVQVLTRLLN 342
            .:..|.:    .|.:...|.|.|..|       .||:.. |.:.|     ..::...:..||.:.
  Rat   534 MVEFSRDAKETTACMPMDFQECSDRT-------PWNKAK-GNLAR-----SSQMEEAEQYTRTIQ 585

  Fly   343 AGFTIEASVGG 353
            ......|..||
  Rat   586 VSLCRNAKRGG 596

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
twzNP_001246449.1 BTB_POZ_KCTD1-like 137..230 CDD:349670 29/92 (32%)
Kctd19XP_008770780.2 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C166350265
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
32.840

Return to query results.
Submit another query.