DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment twz and Kctd1

DIOPT Version :9

Sequence 1:NP_001246449.1 Gene:twz / 37456 FlyBaseID:FBgn0034636 Length:367 Species:Drosophila melanogaster
Sequence 2:NP_001093986.1 Gene:Kctd1 / 291772 RGDID:621566 Length:861 Species:Rattus norvegicus


Alignment Length:364 Identity:153/364 - (42%)
Similarity:198/364 - (54%) Gaps:45/364 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly    23 PKRKKCDMDRERERDVKALEPRDLSSTGRIYARSD-----IKISSSPT-VSPTISNSSSPTPTPP 81
            ||..:...|.:.|...|......:..:|.|...|.     |:.||.|. ....:|....|.|..|
  Rat   512 PKDSQVGPDVKSEAAPKRALYESVFGSGEICGPSSPKRLCIRPSSEPVDAVVVVSVKHDPLPLLP 576

  Fly    82 ASSSVTPLGLPGAVAAAAAAVGGASSAGASSYL--HGNHKPIT--GIPCVAAASRYTAPVHIDVG 142
            ..:.......|..|:.|..:....|....|..|  .....|:.  |||..|..::..||||||||
  Rat   577 EVNGHRSTNSPTIVSPAIVSPTQDSRPNMSRPLITRSPASPLNNQGIPTPAQLTKSNAPVHIDVG 641

  Fly   143 GTIYTSSLETLTKYPESKLAKLFNGQIPIVLDSLKQHYFIDRDGGMFRHILNFMRNSRLLIAEDF 207
            |.:|||||.||||||||::.:||:|..|||||||||||||||||.|||:||||:|.|:|||.:||
  Rat   642 GHMYTSSLATLTKYPESRIGRLFDGTEPIVLDSLKQHYFIDRDGQMFRYILNFLRTSKLLIPDDF 706

  Fly   208 PDLELLLEEARYYEVEPMIKQLESMRKDRVRNGNYLVAPPTPPARHIKTSPRTSASPECNYEVVA 272
            .|..||.|||:|::::||:.::|..::||                  :|| |.|...||    :.
  Rat   707 KDYTLLYEEAKYFQLQPMLLEMERWKQDR------------------ETS-RFSRPCEC----LV 748

  Fly   273 LHISPDLGERIMLSAERALLDELFPEASQATQSSRSGVSWNQGDWGQIIRFPLNGYCKLNSVQVL 337
            :.::|||||||.||.:::|::|:|||......:| ....||. |...:|||||||||.|||||||
  Rat   749 VRVAPDLGERITLSGDKSLIEEVFPEIGDVMCNS-VNAGWNH-DSTHVIRFPLNGYCHLNSVQVL 811

  Fly   338 TRLLNAGFTIEASVGG----QQFSEYLLAR------RVP 366
            .||...||.|..|.||    .|||||:|.|      |||
  Rat   812 ERLQQRGFEIVGSCGGGVDSSQFSEYVLRRELRRTPRVP 850

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
twzNP_001246449.1 BTB_POZ_KCTD1-like 137..230 CDD:349670 63/92 (68%)
Kctd1NP_001093986.1 DNA_BRE_C 279..434 CDD:294145
BTB 636..731 CDD:197585 64/94 (68%)
BTB 636..728 CDD:295341 63/91 (69%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C166350273
Domainoid 1 1.000 136 1.000 Domainoid score I4799
eggNOG 1 0.900 - - E1_KOG2723
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 239 1.000 Inparanoid score I3277
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D412532at33208
OrthoFinder 1 1.000 - - FOG0002897
OrthoInspector 1 1.000 - - otm45727
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR14499
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X1912
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
1110.900

Return to query results.
Submit another query.