DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment twz and KCNRG

DIOPT Version :9

Sequence 1:NP_001246449.1 Gene:twz / 37456 FlyBaseID:FBgn0034636 Length:367 Species:Drosophila melanogaster
Sequence 2:NP_775876.1 Gene:KCNRG / 283518 HGNCID:18893 Length:272 Species:Homo sapiens


Alignment Length:235 Identity:60/235 - (25%)
Similarity:88/235 - (37%) Gaps:73/235 - (31%)


- Green bases have known domain annotations that are detailed below.


  Fly   137 VHIDVGGTIYTSSLETLTKYPESKLAKLFNGQIPIVLDSLKQHY-------FIDRDGGMFRHILN 194
            |.::|||.|:|:...|:.::|.|:||::        ||...|.:       |:||||.:|..||:
Human     7 VTLNVGGKIFTTRFSTIKQFPASRLARM--------LDGRDQEFKMVGGQIFVDRDGDLFSFILD 63

  Fly   195 FMRNSRLLIAEDFPDLELLLEEARYYEVEPMIKQLE----------------------------- 230
            |:|..:||:..:|.|...|..||.:||:..::..|.                             
Human    64 FLRTHQLLLPTEFSDYLRLQREALFYELRSLVDLLNPYLLQPRPALVEVHFLSRNTQAFFRVFGS 128

  Fly   231 -----SMRKDRVR-----------NGNY-------LVAPPTPPARHIKTSPRTSASPECNYEVVA 272
                 .|...|:.           |||:       |..||..|:.|.......|.|...|...|.
Human   129 CSKTIEMLTGRITVFTEQPSAPTWNGNFFPPQMTLLPLPPQRPSYHDLVFQCGSDSTTDNQTGVR 193

  Fly   273 -LHISPD-----LGERIMLSAERALLDELFPEASQATQSS 306
             :.|.||     .|..::......||.|.|...|..|.||
Human   194 YVSIKPDNRKLANGTNVLGLLIDTLLKEGFHLVSTRTVSS 233

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
twzNP_001246449.1 BTB_POZ_KCTD1-like 137..230 CDD:349670 33/99 (33%)
KCNRGNP_775876.1 BTB 7..94 CDD:321966 33/94 (35%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165156334
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG2723
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
32.740

Return to query results.
Submit another query.