DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment twz and KCTD21

DIOPT Version :9

Sequence 1:NP_001246449.1 Gene:twz / 37456 FlyBaseID:FBgn0034636 Length:367 Species:Drosophila melanogaster
Sequence 2:XP_006718579.1 Gene:KCTD21 / 283219 HGNCID:27452 Length:296 Species:Homo sapiens


Alignment Length:285 Identity:77/285 - (27%)
Similarity:128/285 - (44%) Gaps:76/285 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly   113 YLHGNHKPITGIPCVAAASRYTAPVHIDVGGTIYTSSLETLTKYPESKLAKLFNGQIPIVLDSLK 177
            :||     :.|:.....:...:.|:.::|||.:||:||.|||.:|:|.|..:|:|::|...|| :
Human    22 FLH-----LDGLLPATQSPAMSDPITLNVGGKLYTTSLATLTSFPDSMLGAMFSGKMPTKRDS-Q 80

  Fly   178 QHYFIDRDGGMFRHILNFMRNSRLLIAEDFPDLELLLEEARYYEVEPMIKQLESMR--------- 233
            .:.||||||.:||:||||:|.|.|.:.|||.::.||..||.:|:|:|:|:.|:...         
Human    81 GNCFIDRDGKVFRYILNFLRTSHLDLPEDFQEMGLLRREADFYQVQPLIEALQEKEVELSKAEKN 145

  Fly   234 -------KDRVRNGNYLVAPPTPPARHIKTSPRTSASPECNYEVVALHISPD-------LGERIM 284
                   ..||:..::.|          :.:|:..:....:.||...:|...       ||.::.
Human   146 AMLNITLNQRVQTVHFTV----------REAPQIYSLSSSSMEVFNANIFSTSCLFLKLLGSKLF 200

  Fly   285 LSAERAL--------------LD-----ELFPEASQATQSSRSGVSWNQGDWGQIIRFPLNGYCK 330
            ..:...|              ||     |..||.....|:.:           ::...|.|.  :
Human   201 YCSNGNLSSITSHLQDPNHLTLDWVANVEGLPEEEYTKQNLK-----------RLWVVPANK--Q 252

  Fly   331 LNSVQ-----VLTRLLNAGFTIEAS 350
            :||.|     ||...|:.||.|::|
Human   253 INSFQVFVEEVLKIALSDGFCIDSS 277

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
twzNP_001246449.1 BTB_POZ_KCTD1-like 137..230 CDD:349670 44/92 (48%)
KCTD21XP_006718579.1 BTB 41..135 CDD:197585 45/94 (48%)
BTB 41..129 CDD:295341 43/88 (49%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165156338
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG2723
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
32.740

Return to query results.
Submit another query.