DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment twz and Kctd19

DIOPT Version :9

Sequence 1:NP_001246449.1 Gene:twz / 37456 FlyBaseID:FBgn0034636 Length:367 Species:Drosophila melanogaster
Sequence 2:XP_011246701.1 Gene:Kctd19 / 279499 MGIID:3045294 Length:962 Species:Mus musculus


Alignment Length:416 Identity:87/416 - (20%)
Similarity:138/416 - (33%) Gaps:141/416 - (33%)


- Green bases have known domain annotations that are detailed below.


  Fly    35 ERDVKALEPRDLSSTGRIYARSDIKISSSPTV-------------SPTISNSSSPTPTPPAS--- 83
            |.:|:.||..:|:...|:|.   :.::..|.:             .|::...|. |..||.|   
Mouse   248 EAEVEILEIPELTEAVRLYR---MNMALQPALPGPKGSQLSLEQEEPSLGGCSR-TSCPPLSPGK 308

  Fly    84 -------SSVTPLGLPG---AVAAAAAAVG----GASSAGASSYLHGN----------------- 117
                   .||.||.|..   .|....:|:|    .::..|:..|:.||                 
Mouse   309 GGRTASVESVKPLYLMALGLLVKYPDSALGQLRIESTLDGSRLYITGNGALFQHVRNWLGTCRLP 373

  Fly   118 -------------------------------H-KPITGIPCVAAASRYTAPVHI---------DV 141
                                           | :|.|.:|....:..:||.|.|         .|
Mouse   374 LTETISEVYELCAFLDKRDITYEPMKVALKTHLEPRTLLPVDVLSEEWTAEVTIYSPQQIIKLYV 438

  Fly   142 GGTIYTSSLETLTKYPESKLAKLFNGQIPIVLDSLKQHYFIDRDGGMFRHILNFMRNSRLLIAED 206
            |...|.::|:||.||||     |.:....:...:..|...|..||.||||||||:|..:|.:..:
Mouse   439 GSHWYATTLQTLMKYPE-----LLSNTQRVYWIAYGQTLLIHGDGQMFRHILNFLRLGKLFLPSE 498

  Fly   207 FPDLELLLEEARYYEVEPM---IKQLESMRKDRVRNGNYLVAPPTPPARHIKTSPRTSASPECNY 268
            |.:..|..:|...|.:..:   :.|.|:.:.                    .|..:.|.:.|. :
Mouse   499 FKEWPLFCQEVEEYHIPALSEALAQCEAYKS--------------------WTQEKESENEEA-F 542

  Fly   269 EVVALHISPDLGERIMLSAER------ALLDELFPEASQATQSSRSGVSWNQGDWGQIIRFPLNG 327
            .:..||:..: |...|....|      |.:...|.|.|..|       .||:.. |.:.|     
Mouse   543 PIRKLHVVTE-GTGPMAEFSRDAKETTACMPVDFQECSDRT-------PWNKAK-GNLTR----- 593

  Fly   328 YCKLNSVQVLTRLLNAGFTIEASVGG 353
            ..::...:..||.:.......|..||
Mouse   594 SSQMEEAEQYTRTIQVSLCRNAKRGG 619

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
twzNP_001246449.1 BTB_POZ_KCTD1-like 137..230 CDD:349670 32/104 (31%)
Kctd19XP_011246701.1 BTB1_POZ_KCTD19 27..124 CDD:349682
BTB_POZ <196..268 CDD:365784 7/22 (32%)
BTB_POZ 321..389 CDD:365784 9/67 (13%)
BTB2_POZ_KCTD19 432..530 CDD:349683 31/122 (25%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C167846731
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG2723
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.740

Return to query results.
Submit another query.