DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment twz and Kctd8

DIOPT Version :9

Sequence 1:NP_001246449.1 Gene:twz / 37456 FlyBaseID:FBgn0034636 Length:367 Species:Drosophila melanogaster
Sequence 2:NP_780728.3 Gene:Kctd8 / 243043 MGIID:2443804 Length:476 Species:Mus musculus


Alignment Length:245 Identity:66/245 - (26%)
Similarity:109/245 - (44%) Gaps:66/245 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly    79 TPPASSSVTPLGLPGAVAAAAAAVGGASSAGASSYLHGNHKPITGIPCVAAASRYTAPVHIDVGG 143
            |....|::.|:         :..|..:||.||         |:...|...|.|.:...|.::|||
Mouse     6 TGSGGSTILPI---------SEMVSASSSPGA---------PLAAAPGPCAPSPFPEVVELNVGG 52

  Fly   144 TIYTSSLETLTKYPESKLAKLFN-----------GQIPIVLDSLKQHYFIDRDGGMFRHILNFMR 197
            .:|.:...||...|:|.||.:|:           |.:|  .|| :..:||||||.:||::|:::|
Mouse    53 QVYVTKHSTLLSVPDSTLASMFSPSSPRGGARRRGDLP--RDS-RARFFIDRDGFLFRYVLDYLR 114

  Fly   198 NSRLLIAEDFPDLELLLEEARYYEVEPMIKQLESMRKDRVRNGNYLVAPPTPPARHIKTSPRTSA 262
            :.:|.:.|.||:.|.||.||.::::..::|               |::|        |.:.:.|.
Mouse   115 DKQLALPEHFPEKERLLREAEFFQLTDLVK---------------LLSP--------KVTKQNSL 156

  Fly   263 SPECNYEVVALHISPDLGERIMLSAERALLDELFPEASQATQSSRS-GVS 311
            :.||        ...||.:.:...:..|||  |...|:.|...|.: |||
Mouse   157 NDEC--------CQSDLEDNVSQGSSDALL--LRGAAAGAPSGSGAHGVS 196

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
twzNP_001246449.1 BTB_POZ_KCTD1-like 137..230 CDD:349670 36/103 (35%)
Kctd8NP_780728.3 BTB 46..145 CDD:197585 36/116 (31%)
BTB 46..142 CDD:295341 35/98 (36%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 331..412
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C167846738
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG2723
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
43.740

Return to query results.
Submit another query.