DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment twz and Tnfaip1

DIOPT Version :9

Sequence 1:NP_001246449.1 Gene:twz / 37456 FlyBaseID:FBgn0034636 Length:367 Species:Drosophila melanogaster
Sequence 2:NP_001152864.1 Gene:Tnfaip1 / 21927 MGIID:104961 Length:316 Species:Mus musculus


Alignment Length:180 Identity:40/180 - (22%)
Similarity:91/180 - (50%) Gaps:33/180 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly   119 KP-ITGIPCVAAASRYTAPVHIDVGGTIYTSSLETLTKYPESKLAKLFNGQIPIVLDSLKQHY-F 181
            || |:|.......::|   |.::|||::|.:::..||:: ::.|..:|:|::.::.|  |:.: .
Mouse    14 KPKISGFKGGGLGNKY---VQLNVGGSLYYTTVRALTRH-DTMLKAMFSGRMEVLTD--KEGWIL 72

  Fly   182 IDRDGGMFRHILNFMRNSRLLIAEDFPDLELLLEEARYYEVEPMIKQLESMRKDRVRNGNYLVAP 246
            |||.|..|..|||::|:..:.:.:...:::.|:.||:||.::.::...::..:|:          
Mouse    73 IDRCGKHFGTILNYLRDDTITLPQSRQEIQELMAEAKYYLIQGLVSTCQTALQDK---------- 127

  Fly   247 PTPPARHIKTSPRTSASPECNYEVVALHISPDLGERIMLSAERALLDELF 296
                        :.|..|.||..::......|   |::.|:.:.::..|:
Mouse   128 ------------KDSYQPVCNIPIITSLREED---RLIESSTKPVVKLLY 162

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
twzNP_001246449.1 BTB_POZ_KCTD1-like 137..230 CDD:349670 26/93 (28%)
Tnfaip1NP_001152864.1 BTB 29..127 CDD:197585 27/103 (26%)
BTB_2 30..120 CDD:280393 26/92 (28%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 268..288
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.