DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment twz and Kctd7

DIOPT Version :9

Sequence 1:NP_001246449.1 Gene:twz / 37456 FlyBaseID:FBgn0034636 Length:367 Species:Drosophila melanogaster
Sequence 2:NP_766097.1 Gene:Kctd7 / 212919 MGIID:2442265 Length:289 Species:Mus musculus


Alignment Length:159 Identity:51/159 - (32%)
Similarity:85/159 - (53%) Gaps:34/159 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly    93 GAVAAAAA-------AVGGASSAGASSYLHGNHKPITGIPCVAAASRYTAPVHIDVGGTIYTSSL 150
            ||::::.|       |...|:.||        |    |:|.:  ...:...|.:::||..:|:.|
Mouse    16 GAMSSSEAEDDFLEPATPTATQAG--------H----GLPLL--PQEFPEVVPLNIGGAHFTTRL 66

  Fly   151 ETLTKYPESKLAKLFNGQIPIVLDSLKQHYFIDRDGGMFRHILNFMRNSRLLIAEDFPDLE---L 212
            .||.:|.::.||.:|:|:..|..|| :..|||||||..|..:|||:|:.      |.|..|   .
Mouse    67 STLRRYEDTMLAAMFSGRHYIPTDS-EGRYFIDRDGTHFGDVLNFLRSG------DLPPREHVRA 124

  Fly   213 LLEEARYYEVEPMIKQLESM---RKDRVR 238
            :.:||:||.:.|:::|||:|   :.::||
Mouse   125 VHKEAQYYAIGPLLEQLENMQPLKGEKVR 153

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
twzNP_001246449.1 BTB_POZ_KCTD1-like 137..230 CDD:349670 36/95 (38%)
Kctd7NP_766097.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..42 8/37 (22%)
BTB_POZ_KCTD7 48..139 CDD:349675 35/97 (36%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C167846730
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG2723
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
43.740

Return to query results.
Submit another query.