DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment twz and Kctd12b

DIOPT Version :9

Sequence 1:NP_001246449.1 Gene:twz / 37456 FlyBaseID:FBgn0034636 Length:367 Species:Drosophila melanogaster
Sequence 2:NP_780638.1 Gene:Kctd12b / 207474 MGIID:2444667 Length:292 Species:Mus musculus


Alignment Length:284 Identity:63/284 - (22%)
Similarity:119/284 - (41%) Gaps:72/284 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly   137 VHIDVGGTIYTSSLETLTKYPESKLAKLFNGQIP--IVLDSLKQHYFIDRDGGMFRHILNFMRNS 199
            :.::|||.:|.:...||...|.|:|.::|:.:.|  ::.|: |..:||||||.:||::|::||:.
Mouse    23 IELNVGGQVYITRYPTLISIPGSRLWEMFSVKNPCSLIQDN-KGRFFIDRDGFLFRYVLDYMRDM 86

  Fly   200 RLLIAEDFPDLELLLEEARYYE-------VEPMIKQLESMRKDRV-------------------R 238
            ::::.:.||:...|..||.|::       :.|.:.:|.|:..|..                   .
Mouse    87 QVVLPDHFPECGRLHREAEYFKLPELAKMLAPKMNKLNSIGNDSCPIDLEELSPSIDTTFNFSST 151

  Fly   239 NGNYLVAPPTPPARHIKTSPRTSASPECNYEVVALHISPDLGE------------RIMLSAERAL 291
            |..::..|..|..  ::.:| .|...:..:..:....|..||.            |||:..:.:|
Mouse   152 NSIHISGPDNPMV--LRAAP-GSELKKAGFITIGYRGSYTLGRDSQADAKFRRVARIMVCGKISL 213

  Fly   292 LDELFPEA-SQATQSSRSGVSWNQGDWGQIIRFPLNGYCKLNSV-QVLTRLLNAGFTIEA--SVG 352
            ..|:|.:. :::....|...           |:....|.|...: |...:|.:|||.:.|  |.|
Mouse   214 AKEVFGDTLNESRDPDRPPE-----------RYTSRYYLKFTFLEQAFDKLADAGFHMVACNSTG 267

  Fly   353 -------------GQQFSEYLLAR 363
                         ...::||:..|
Mouse   268 TCTVTHDQTDDRIWTSYTEYVFYR 291

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
twzNP_001246449.1 BTB_POZ_KCTD1-like 137..230 CDD:349670 31/101 (31%)
Kctd12bNP_780638.1 BTB_POZ_KCTD8-like 19..118 CDD:349676 30/95 (32%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C167846737
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG2723
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
43.740

Return to query results.
Submit another query.