DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment twz and ZC239.3

DIOPT Version :9

Sequence 1:NP_001246449.1 Gene:twz / 37456 FlyBaseID:FBgn0034636 Length:367 Species:Drosophila melanogaster
Sequence 2:NP_001370450.1 Gene:ZC239.3 / 191120 WormBaseID:WBGene00022566 Length:248 Species:Caenorhabditis elegans


Alignment Length:210 Identity:48/210 - (22%)
Similarity:76/210 - (36%) Gaps:65/210 - (30%)


- Green bases have known domain annotations that are detailed below.


  Fly   137 VHIDVGGTIYTSSLETLTKYPESKLAKLFNGQIPIVL----DSLKQHYFIDRDGGMFRHILNFMR 197
            :.:::||..:.:...||.|         |:|.....|    .||....|:||....|..:|||||
 Worm     9 IRLNIGGKRFDTHKSTLMK---------FDGYFKKFLQTPGSSLVDPIFVDRSPTYFDIVLNFMR 64

  Fly   198 NSRLLIAEDFPDLELLLEEARYYEVEPMIKQLESMRKDRVRNGNYLVAPPTPPARHIKTSPRTSA 262
            ..|..:.|...||::||:||.|||:                                     |..
 Worm    65 KGRADLPETLIDLKMLLDEAEYYEL-------------------------------------TEL 92

  Fly   263 SPECNYEVVALHISPDLGERIMLSAERALLDELFPEASQATQSSRSGVSWNQGDWGQIIRFPLNG 327
            ..:|..|:..|    |:|      .|.....|:.||.|...:::.:.:..|..:.|     .|:|
 Worm    93 CDDCKREISIL----DIG------IESEPFHEIIPEVSVVARNNNNAIPNNVVEVG-----TLSG 142

  Fly   328 YCKLNSVQVLTRLLN 342
            ..:.....|.:.|:|
 Worm   143 VAQKIKENVRSSLVN 157

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
twzNP_001246449.1 BTB_POZ_KCTD1-like 137..230 CDD:349670 30/96 (31%)
ZC239.3NP_001370450.1 BTB_2 9..96 CDD:396684 31/132 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 1 0.950 - 0 Normalized mean entropy S4982
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.860

Return to query results.
Submit another query.