DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment twz and T23G5.3

DIOPT Version :9

Sequence 1:NP_001246449.1 Gene:twz / 37456 FlyBaseID:FBgn0034636 Length:367 Species:Drosophila melanogaster
Sequence 2:NP_499040.2 Gene:T23G5.3 / 188816 WormBaseID:WBGene00011963 Length:262 Species:Caenorhabditis elegans


Alignment Length:119 Identity:34/119 - (28%)
Similarity:57/119 - (47%) Gaps:8/119 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly   137 VHIDVGGTIYTSSLETLTKYPESKLAKLFNGQIPIVLDSLKQHYFIDRDGGMFRHILNFMR-NSR 200
            :.:||.|..:.:.:.||.....:...|||.......||. ....|||||..:|..||||:| :.:
 Worm     7 ISLDVEGVYFKTRIATLKSIEGTYFTKLFETNWREQLDR-DGRLFIDRDSSVFPVILNFLRDHEK 70

  Fly   201 LLIAEDFPDLELLLEEARYYEVEPMIKQLESMRKDRVRNGNYLVAPPTPPARHI 254
            ..:.:|...|..:|.||.::::.|    |.:|.:.::|  .:...||..|:..|
 Worm    71 CSLPKDEYQLMRILREAVFFKIGP----LRNMIEHKLR--TFCTCPPELPSTPI 118

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
twzNP_001246449.1 BTB_POZ_KCTD1-like 137..230 CDD:349670 27/93 (29%)
T23G5.3NP_499040.2 BTB 7..106 CDD:197585 30/105 (29%)
BTB 7..95 CDD:295341 27/92 (29%)
PBD 182..217 CDD:197628
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG2723
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.