DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment twz and F47D12.3

DIOPT Version :9

Sequence 1:NP_001246449.1 Gene:twz / 37456 FlyBaseID:FBgn0034636 Length:367 Species:Drosophila melanogaster
Sequence 2:NP_498381.1 Gene:F47D12.3 / 185932 WormBaseID:WBGene00018560 Length:140 Species:Caenorhabditis elegans


Alignment Length:112 Identity:32/112 - (28%)
Similarity:57/112 - (50%) Gaps:18/112 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly   137 VHIDVGGTIYTSSLETL-------------TKYPESKLAKLFNGQIPIVLDSLKQHYFIDRDGGM 188
            :::.|||.:|...::||             .|..::.: |:...|.....:.:|....|||||.:
 Worm    14 LNLFVGGEMYPVQVKTLMNPTTCGSYFRDVVKVSDAAI-KVRGVQWDTAPNHIKFRVDIDRDGVL 77

  Fly   189 FRHILNFMRNSRLL-IAEDFPDLELLLEEARYYEVEPMIKQLESMRK 234
            |||:|.::||.:|. :.:|...||.|:.||.::.:|   |..|.::|
 Worm    78 FRHVLQYLRNGKLTSLPDDIFTLESLVAEAEFFGLE---KYREMLKK 121

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
twzNP_001246449.1 BTB_POZ_KCTD1-like 137..230 CDD:349670 30/106 (28%)
F47D12.3NP_498381.1 BTB <71..114 CDD:295341 19/45 (42%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG2723
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.