powered by:
Protein Alignment twz and F22E5.13
DIOPT Version :9
Sequence 1: | NP_001246449.1 |
Gene: | twz / 37456 |
FlyBaseID: | FBgn0034636 |
Length: | 367 |
Species: | Drosophila melanogaster |
Sequence 2: | NP_494319.2 |
Gene: | F22E5.13 / 184841 |
WormBaseID: | WBGene00017711 |
Length: | 98 |
Species: | Caenorhabditis elegans |
Alignment Length: | 71 |
Identity: | 18/71 - (25%) |
Similarity: | 25/71 - (35%) |
Gaps: | 15/71 - (21%) |
- Green bases have known domain annotations that are detailed below.
Fly 78 PTPPASSSVTPLGL------PGAVAAAAAAVGGASSAGASSYLHGNHKPITGI---------PCV 127
||.|..::||..|: ...:|||...:.......|...|...|:.|.|. .|.
Worm 11 PTRPKDATVTSYGIYVKEVFSEILAAAWETISNWDPKTAGETLQFAHRGIRGTLSFLTDSKRLCG 75
Fly 128 AAASRY 133
.|||.:
Worm 76 VAASSF 81
|
Known Domains:
Indicated by green bases in alignment.
Gene | Sequence | Domain | Region |
External ID | Identity |
twz | NP_001246449.1 |
BTB_POZ_KCTD1-like |
137..230 |
CDD:349670 |
|
F22E5.13 | NP_494319.2 |
None |
Blue background indicates that the domain is not in
the aligned region.
|
Information from Original Tools:
Tool |
Simple Score |
Weighted Score |
Original Tool Information |
BLAST Result |
Score |
Score Type |
Cluster ID |
Compara |
0 | 0.000 |
Not matched by this tool. |
Domainoid |
0 | 0.000 |
Not matched by this tool. |
eggNOG |
0 | 0.000 |
Not matched by this tool. |
Hieranoid |
0 | 0.000 |
Not matched by this tool. |
Homologene |
0 | 0.000 |
Not matched by this tool. |
Inparanoid |
0 | 0.000 |
Not matched by this tool. |
Isobase |
0 | 0.000 |
Not matched by this tool. |
OMA |
0 | 0.000 |
Not matched by this tool. |
OrthoDB |
0 | 0.000 |
Not matched by this tool. |
OrthoFinder |
0 | 0.000 |
Not matched by this tool. |
OrthoInspector |
0 | 0.000 |
Not matched by this tool. |
orthoMCL |
0 | 0.000 |
Not matched by this tool. |
Panther |
0 | 0.000 |
Not matched by this tool. |
Phylome |
1 |
0.910 |
- |
- |
|
|
RoundUp |
0 | 0.000 |
Not matched by this tool. |
SonicParanoid |
0 | 0.000 |
Not matched by this tool. |
SwiftOrtho |
0 | 0.000 |
Not matched by this tool. |
TreeFam |
0 | 0.000 |
Not matched by this tool. |
|
1 | 0.910 |
|
Return to query results.
Submit another query.