DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment twz and ZC239.6

DIOPT Version :9

Sequence 1:NP_001246449.1 Gene:twz / 37456 FlyBaseID:FBgn0034636 Length:367 Species:Drosophila melanogaster
Sequence 2:NP_494474.2 Gene:ZC239.6 / 173663 WormBaseID:WBGene00022569 Length:258 Species:Caenorhabditis elegans


Alignment Length:243 Identity:56/243 - (23%)
Similarity:94/243 - (38%) Gaps:79/243 - (32%)


- Green bases have known domain annotations that are detailed below.


  Fly   137 VHIDVGGTIYTSSLETLTKY-------PESKLAKLFNGQIPIVLDSLKQHYFIDRDGGMFRHILN 194
            :.::|||..:.:|..||||:       ||   .:..|...||         |:||....|..|||
 Worm     2 LRLNVGGKEFVTSKATLTKFDGYFKNLPE---IQQVNPTSPI---------FVDRSPKHFETILN 54

  Fly   195 FMRNSRLLIAEDFPDLELLLEEARYYEVEPMIKQLE-------------SMRKD-------RVRN 239
            |||:..:.:.:::  |..||.|||:|.:..:::..|             |.|.|       ..|:
 Worm    55 FMRDGDVDLPQEY--LNQLLREARFYGLVKLVRDCEQAIARLDVGSGRPSERADPLSDIICNCRS 117

  Fly   240 GNYLVAPPT------PPARHIKTSPRTSASPECNYEVVALHISPDLGERIMLSAERALLD-ELFP 297
            .:..|||..      ||.:....|  .::.||.           |..:.|:.::|:.:|: |..|
 Worm   118 TSNNVAPAVVNSEIKPPNKENDLS--IASVPEY-----------DANQNIVKNSEKMMLEIEKIP 169

  Fly   298 EA-----------------SQATQSSRSGVS-WNQGDWGQIIRFPLNG 327
            ..                 |....::|..:| |:....|:.::|...|
 Worm   170 SPPKDAKIENYDDYLKLVFSNIIDAARDKISNWDFKKAGEALQFAHRG 217

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
twzNP_001246449.1 BTB_POZ_KCTD1-like 137..230 CDD:349670 30/99 (30%)
ZC239.6NP_494474.2 BTB 2..87 CDD:383002 30/98 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 1 0.950 - 0 Normalized mean entropy S4982
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.860

Return to query results.
Submit another query.