DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment twz and KCTD19

DIOPT Version :9

Sequence 1:NP_001246449.1 Gene:twz / 37456 FlyBaseID:FBgn0034636 Length:367 Species:Drosophila melanogaster
Sequence 2:NP_001094385.1 Gene:KCTD19 / 146212 HGNCID:24753 Length:926 Species:Homo sapiens


Alignment Length:412 Identity:85/412 - (20%)
Similarity:132/412 - (32%) Gaps:135/412 - (32%)


- Green bases have known domain annotations that are detailed below.


  Fly    36 RDVKALEPRDLSSTGRIYARSDIKISSSPTVSPTI------SNSSSPTPTPPAS----------S 84
            |..|.|.|.:.|:...:.|  :::|...|.::..:      ....|||...|.|          .
Human   219 RSQKILLPDNFSNIDVLEA--EVEILEIPALTEAVRWYRMNMGGCSPTTCSPLSPGKGARTASLE 281

  Fly    85 SVTP-----LGLPGAVAAAAAAVG----GASSAGASSYLHGN----------------------- 117
            ||.|     |||  .|....:|:|    .::..|:..|:.||                       
Human   282 SVKPLYTMALGL--LVKYPDSALGQLRIESTLDGSRLYITGNGVLFQHVKNWLGTCRLPLTETIS 344

  Fly   118 ----------HKPITGIPCVAAASRYTAP------------------------VHIDVGGTIYTS 148
                      .:.||..|...|...:..|                        :.:.||...|.:
Human   345 EVYELCAFLDKRDITYEPIKVALKTHLEPRTLAPMDVLNEWTAEITVYSPQQIIKVYVGSHWYAT 409

  Fly   149 SLETLTKYPESKLAKLFNGQIPIVLDSLKQHYFIDRDGGMFRHILNFMRNSRLLIAEDFPDLELL 213
            :|:||.||||     |.:....:...:..|...|..||.||||||||:|..:|.:..:|.:..|.
Human   410 TLQTLLKYPE-----LLSNPQRVYWITYGQTLLIHGDGQMFRHILNFLRLGKLFLPSEFKEWPLF 469

  Fly   214 LEEARYYEVEPMI---------------KQLESMRKDRVRNGNYLVAPPTPPARHIKTSPRTSAS 263
            .:|...|.:..:.               |:.|:.....:|..:.:...|.......:.:..|:|.
Human   470 CQEVEEYHIPSLSEALAQCEAYKSWTQEKESENEEAFSIRRLHVVTEGPGSLVEFSRDTKETTAY 534

  Fly   264 PECNYEVVALHISPDLGERI--------------MLSAE---RALLDELFPEASQA----TQSSR 307
            ...::|        |..:|.              |..||   |.:...|...|.:|    |.|..
Human   535 MPVDFE--------DCSDRTPWNKAKGNLVRSNQMDEAEQYTRPIQVSLCRNAKRAGNPSTYSHC 591

  Fly   308 SGVSWNQGDWGQIIRFPLNGYC 329
            .|:..|.|.||.....|....|
Human   592 RGLCTNPGHWGSHPESPPKKKC 613

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
twzNP_001246449.1 BTB_POZ_KCTD1-like 137..230 CDD:349670 30/107 (28%)
KCTD19NP_001094385.1 BTB 18..>72 CDD:321966
BTB 398..488 CDD:321966 29/94 (31%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 673..751
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165156333
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG2723
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
32.740

Return to query results.
Submit another query.