DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment twz and KCTD18

DIOPT Version :9

Sequence 1:NP_001246449.1 Gene:twz / 37456 FlyBaseID:FBgn0034636 Length:367 Species:Drosophila melanogaster
Sequence 2:NP_001308476.1 Gene:KCTD18 / 130535 HGNCID:26446 Length:426 Species:Homo sapiens


Alignment Length:86 Identity:29/86 - (33%)
Similarity:52/86 - (60%) Gaps:2/86 - (2%)


- Green bases have known domain annotations that are detailed below.


  Fly   137 VHIDVGGTIYTSSLETLTKYPESKLAKLFNGQIPIVLDSLKQHYFIDRDGGMFRHILNFMRNSRL 201
            :.::|||.|||:..|:|.::.:|.||.:|:|:.|:..|. .....|||||.:|:::|::: :..:
Human    14 LRLNVGGCIYTARRESLCRFKDSMLASMFSGRFPLKTDE-SGACVIDRDGRLFKYLLDYL-HGEV 76

  Fly   202 LIAEDFPDLELLLEEARYYEV 222
            .|..|......|.|||.|:.:
Human    77 QIPTDEQTRIALQEEADYFGI 97

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
twzNP_001246449.1 BTB_POZ_KCTD1-like 137..230 CDD:349670 29/86 (34%)
KCTD18NP_001308476.1 BTB 12..98 CDD:197585 29/86 (34%)
BTB 14..98 CDD:295341 29/86 (34%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 305..371
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 389..408
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165156342
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG2723
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
32.740

Return to query results.
Submit another query.