DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment twz and AgaP_AGAP000083

DIOPT Version :9

Sequence 1:NP_001246449.1 Gene:twz / 37456 FlyBaseID:FBgn0034636 Length:367 Species:Drosophila melanogaster
Sequence 2:XP_311068.3 Gene:AgaP_AGAP000083 / 1272187 VectorBaseID:AGAP000083 Length:222 Species:Anopheles gambiae


Alignment Length:157 Identity:42/157 - (26%)
Similarity:75/157 - (47%) Gaps:28/157 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly    82 ASSSVTPLGLPGAVAAAAAAVGGASSAGASSYLHGNHKPITGIPCVAAASRYTAPVHIDVGGTIY 146
            |:.::.|.|.|   .|...|||.:                |.|..:....::   |.::||||.:
Mosquito     2 ATVNLNPNGCP---VATPTAVGSS----------------TSIHSIQGKDQW---VKLNVGGTCF 44

  Fly   147 TSSLETLTKYPESKLAKLFNGQIPIVLDSLKQ-HYFIDRDGGMFRHILNFMRNSRLLIAEDFPDL 210
            .::..||::.|.|.|::|......::.|..:. .|.||||...|..:||::|:.:|::.:...: 
Mosquito    45 LTTKTTLSRDPNSFLSRLIQEDSDLISDRDETGAYLIDRDPRYFAPVLNYLRHGKLVLDDGLSE- 108

  Fly   211 ELLLEEARYYEVEPMIKQLESMRKDRV 237
            |.:||||.:|.|..:|    .:.||.:
Mosquito   109 EGVLEEAEFYNVTHLI----GLLKDNI 131

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
twzNP_001246449.1 BTB_POZ_KCTD1-like 137..230 CDD:349670 30/93 (32%)
AgaP_AGAP000083XP_311068.3 BTB 34..135 CDD:197585 32/106 (30%)
BTB_2 35..124 CDD:280393 29/89 (33%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.