DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment twz and AgaP_AGAP000478

DIOPT Version :9

Sequence 1:NP_001246449.1 Gene:twz / 37456 FlyBaseID:FBgn0034636 Length:367 Species:Drosophila melanogaster
Sequence 2:XP_310614.4 Gene:AgaP_AGAP000478 / 1271761 VectorBaseID:AGAP000478 Length:324 Species:Anopheles gambiae


Alignment Length:265 Identity:73/265 - (27%)
Similarity:116/265 - (43%) Gaps:73/265 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly   129 AASRYTAP---------VHIDVGGTIYTSSLETLT-KYPESKLAKLFNGQIPIVLDSLKQ----- 178
            ||.| |||         |.::|||.|:|::..||| :.|.|.:|::|      ..|.||.     
Mosquito    21 AAIR-TAPEPDGRAERWVTLNVGGEIFTTTRLTLTNREPNSMIARMF------AQDQLKPAEQDG 78

  Fly   179 --HYFIDRDGGMFRHILNFMRNSRLLIAEDFPDLELLLEEARYYEVEPMIKQLESMRKDRVRNGN 241
              .|.|||:|..||.||:::|:.| :|.:....|:.:|||||||.::.:.:.::.:.:..|    
Mosquito    79 QGAYLIDRNGHYFRPILDYLRHGR-VIYDPHVSLQGILEEARYYGLDGLARLIQEIERADV---- 138

  Fly   242 YLVAPPTPPARHIKTSPRTSASPECNYEVVALHISP------DLGERIMLSAERALLDELFPEAS 300
                 .......|:|...:|.:.|..::  .:|:|.      ||..   ::.:.|.|..      
Mosquito   139 -----SLTRLDFIRTLVTSSHTTELRFQ--GVHLSGINLSKLDLRN---INFKYACLSH------ 187

  Fly   301 QATQSSRSGVSWNQGDWGQIIRFPLNGYCKLNSVQV--------------LTR--LLNA---GFT 346
              ...|.:.:||...:..::....|.| .||:||..              |||  |.||   |.|
Mosquito   188 --CNLSYANLSWCCLERAELRCANLEG-AKLHSVMAACADLQGAKLKCCDLTRCSLENANMKGAT 249

  Fly   347 IEASV 351
            :|.||
Mosquito   250 LEGSV 254

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
twzNP_001246449.1 BTB_POZ_KCTD1-like 137..230 CDD:349670 36/100 (36%)
AgaP_AGAP000478XP_310614.4 BTB 36..133 CDD:197585 36/103 (35%)
BTB 37..127 CDD:295341 36/96 (38%)
Pentapeptide_4 159..235 CDD:290330 15/89 (17%)
Pentapeptide 160..196 CDD:279183 7/48 (15%)
Pentapeptide 183..215 CDD:279183 7/40 (18%)
Pentapeptide 223..257 CDD:279183 11/32 (34%)
Pentapeptide_4 234..310 CDD:290330 11/21 (52%)
Pentapeptide 268..307 CDD:279183
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.