DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment twz and AgaP_AGAP007046

DIOPT Version :9

Sequence 1:NP_001246449.1 Gene:twz / 37456 FlyBaseID:FBgn0034636 Length:367 Species:Drosophila melanogaster
Sequence 2:XP_308716.2 Gene:AgaP_AGAP007046 / 1270054 VectorBaseID:AGAP007046 Length:550 Species:Anopheles gambiae


Alignment Length:214 Identity:50/214 - (23%)
Similarity:72/214 - (33%) Gaps:86/214 - (40%)


- Green bases have known domain annotations that are detailed below.


  Fly    97 AAAAAVGGASSAGASSYLHGNHKPITGIPCVAAASRYTAPVH------------IDVGGTIYTSS 149
            |.|||:|..              ||...|..|      .||.            |:|.|..:.:.
Mosquito    11 ARAAAIGWV--------------PIASHPLPA------PPVFKDRLRSEDEKLIINVSGRRFETW 55

  Fly   150 LETLTKYPESKLAKLFNGQIPIVLDSLKQHYFIDRDGGMFRHILNFMRNSRLLIAEDFPDLELLL 214
            ..|:.|||::.|.   :.:.....|...:.||.|||..:||||||:.|..:|    .:|..|.||
Mosquito    56 RTTVEKYPDTLLG---SNERDFFYDEDSKEYFFDRDPDIFRHILNYYRTGKL----HYPRHECLL 113

  Fly   215 ---EEARYYEVEPMIKQLESMRKDRVRNGNYLVAPPTPPARHIKTSPRTSASPECNYEVVALHIS 276
               ||..::.:.|                                    ....:|.||       
Mosquito   114 SYDEELAFFGIMP------------------------------------DVIGDCCYE------- 135

  Fly   277 PDLGERIMLSAERALLDEL 295
             |..:|...:|||.:.|:|
Mosquito   136 -DYRDRKRENAERLMDDKL 153

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
twzNP_001246449.1 BTB_POZ_KCTD1-like 137..230 CDD:349670 30/107 (28%)
AgaP_AGAP007046XP_308716.2 BTB_POZ_Shal-like 6..144 CDD:349727 45/203 (22%)
Ion_trans 184..415 CDD:395416
DUF3399 459..543 CDD:403174
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.