DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment twz and KCTD12

DIOPT Version :9

Sequence 1:NP_001246449.1 Gene:twz / 37456 FlyBaseID:FBgn0034636 Length:367 Species:Drosophila melanogaster
Sequence 2:NP_612453.1 Gene:KCTD12 / 115207 HGNCID:14678 Length:325 Species:Homo sapiens


Alignment Length:210 Identity:54/210 - (25%)
Similarity:90/210 - (42%) Gaps:62/210 - (29%)


- Green bases have known domain annotations that are detailed below.


  Fly    90 GLPGAVAAAAAAVGGASSAGASSYLHGNHKPITGIPCVAAASRYTAPVHIDVGGTIYTSSLETLT 154
            |||.         ||....|:.|.......|:  .|.:         |.::|||.:|.:...|:.
Human     9 GLPN---------GGGGGGGSGSSSSSAEPPL--FPDI---------VELNVGGQVYVTRRCTVV 53

  Fly   155 KYPESKLAKLFNGQIP--IVLDSLKQHYFIDRDGGMFRHILNFMRNSRLLIAEDFPDLELLLEEA 217
            ..|:|.|.::|..|.|  :..|| |..:|:||||.:||:||:::|:.:|::.:.||:...|..||
Human    54 SVPDSLLWRMFTQQQPQELARDS-KGRFFLDRDGFLFRYILDYLRDLQLVLPDYFPERSRLQREA 117

  Fly   218 RYYEVEPMIKQLESMRKDRVRNGNYLVAPPTPPARHIKTSPRTSASPECNYEVVALHISPDLGER 282
            .|:|:..::::|.:.::.         .|..||:|.                  .:|....||  
Human   118 EYFELPELVRRLGAPQQP---------GPGPPPSRR------------------GVHKEGSLG-- 153

  Fly   283 IMLSAERALLDELFP 297
                      |||.|
Human   154 ----------DELLP 158

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
twzNP_001246449.1 BTB_POZ_KCTD1-like 137..230 CDD:349670 33/94 (35%)
KCTD12NP_612453.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..28 7/27 (26%)
BTB 36..125 CDD:321966 33/89 (37%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 129..202 12/69 (17%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG2723
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.