DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment twz and kctd8

DIOPT Version :9

Sequence 1:NP_001246449.1 Gene:twz / 37456 FlyBaseID:FBgn0034636 Length:367 Species:Drosophila melanogaster
Sequence 2:XP_004921519.2 Gene:kctd8 / 100492650 XenbaseID:XB-GENE-1011213 Length:419 Species:Xenopus tropicalis


Alignment Length:287 Identity:71/287 - (24%)
Similarity:113/287 - (39%) Gaps:90/287 - (31%)


- Green bases have known domain annotations that are detailed below.


  Fly   133 YTAP--VHIDVGGTIYTSSLETLTKYPESKLAKLFN-GQIPIVLDSLKQHYFIDRDGGMFRHILN 194
            |..|  :.::|||.:|.:...|||..|:|.|..:|| ..:..:....:..:||||||.:||:||:
 Frog    15 YPFPDVIELNVGGQVYVTKHTTLTSVPDSTLYSMFNRNNVKEMPRDNRTRFFIDRDGFLFRYILD 79

  Fly   195 FMRNSRLLIAEDFPDLELLLEEARYYEVEPMIKQLESMRKDRVRNGNYLVAPPTPPARHIKTSPR 259
            |:|:.:|.:.:.||:.|.||.||.|:::..::|.|                  ||     |.:.:
 Frog    80 FLRDKQLSLPDHFPEKERLLREAEYFQLGDLVKLL------------------TP-----KVTKQ 121

  Fly   260 TSASPE-CNYEVVALHISPDLGE-----------------------------------RIMLSAE 288
            :|.:.| |..::.....|.||..                                   |||:...
 Frog   122 SSLNDEGCQSDIEDSSQSSDLVRTAALDKKSGFITIGYRGSYTMVRDNQADAKFRRVARIMVCGR 186

  Fly   289 RALLDELFPEA-SQATQSSRSGVSWNQGDWGQIIRFPLNGYCKLNSV-QVLTRLLNAGFTIEA-- 349
            .||..|:|.:. :::....|....:..       ||    |.|...: |...||..|||.:.|  
 Frog   187 IALAKEVFGDTLNESRDPDRPPEKYTS-------RF----YLKFTYLEQAFDRLSEAGFHMVACN 240

  Fly   350 SVGGQQF-------------SEYLLAR 363
            |.|...|             :||:..|
 Frog   241 STGTAAFVNQYRDDKIWSSYTEYIFYR 267

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
twzNP_001246449.1 BTB_POZ_KCTD1-like 137..230 CDD:349670 34/93 (37%)
kctd8XP_004921519.2 BTB_POZ_KCTD8 16..118 CDD:349704 38/124 (31%)
H1_KCTD8 146..267 CDD:409029 24/131 (18%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.