DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment twz and kctd1

DIOPT Version :9

Sequence 1:NP_001246449.1 Gene:twz / 37456 FlyBaseID:FBgn0034636 Length:367 Species:Drosophila melanogaster
Sequence 2:XP_012820753.2 Gene:kctd1 / 100486970 XenbaseID:XB-GENE-6076050 Length:840 Species:Xenopus tropicalis


Alignment Length:346 Identity:146/346 - (42%)
Similarity:194/346 - (56%) Gaps:59/346 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly    47 SSTGRIYARSDIKISSSP---TVSP--------TISNSSSPTPTPPASSSVTPLGLPGAVAAAAA 100
            :|...|||..|:....||   .:.|        .:|..|.|.|:.|.::.       ..|.||:.
 Frog   509 NSAHSIYASGDMGSPPSPKRLCIRPADPSDCVHVVSVKSDPQPSCPETNG-------HMVLAASP 566

  Fly   101 AVGGASSAGASSYLHGN-HKPI-----------TGIPCVAAASRYTAPVHIDVGGTIYTSSLETL 153
            ||...|..........| .:|:           .|||..|..::..|||||||||.:|||||.||
 Frog   567 AVTSPSVMSPVQDTRPNMSRPLITRSPASPLSNQGIPTPAQLTKSNAPVHIDVGGHMYTSSLATL 631

  Fly   154 TKYPESKLAKLFNGQIPIVLDSLKQHYFIDRDGGMFRHILNFMRNSRLLIAEDFPDLELLLEEAR 218
            ||||:|::.:||:|..|||||||||||||||||.|||:||||:|.|:|||::||.|..||.|||:
 Frog   632 TKYPDSRIGRLFDGTEPIVLDSLKQHYFIDRDGQMFRYILNFLRTSKLLISDDFKDYSLLYEEAK 696

  Fly   219 YYEVEPMIKQLESMRKDRVRNGNYLVAPPTPPARHIKTSPRTSASPECNYEVVALHISPDLGERI 283
            |::::||:.:||..::|                   |.:.|.|...||    :.:.::|||||||
 Frog   697 YFQLQPMLLELERWKQD-------------------KEAGRFSRPCEC----LVVRVAPDLGERI 738

  Fly   284 MLSAERALLDELFPEASQATQSSRSGVSWNQGDWGQIIRFPLNGYCKLNSVQVLTRLLNAGFTIE 348
            .||.:::|::|:|||......:| ....||. |...:|||||||||.|||||||.||.:.||.|.
 Frog   739 TLSGDKSLIEEVFPEIGDVMCNS-VNAGWNH-DSTHVIRFPLNGYCHLNSVQVLERLQHRGFEIV 801

  Fly   349 ASVGG----QQFSEYLLARRV 365
            .|.||    .|||||:|.|.:
 Frog   802 GSCGGGVDSSQFSEYVLRREL 822

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
twzNP_001246449.1 BTB_POZ_KCTD1-like 137..230 CDD:349670 62/92 (67%)
kctd1XP_012820753.2 DNA_BRE_C 270..435 CDD:412227
BTB_POZ_KCTD1 611..715 CDD:349695 67/122 (55%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 135 1.000 Domainoid score I4933
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D412532at33208
OrthoFinder 1 1.000 - - FOG0002897
OrthoInspector 1 1.000 - - otm48821
Panther 1 1.100 - - O PTHR14499
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X1912
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
77.020

Return to query results.
Submit another query.