DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment twz and kctd6a

DIOPT Version :9

Sequence 1:NP_001246449.1 Gene:twz / 37456 FlyBaseID:FBgn0034636 Length:367 Species:Drosophila melanogaster
Sequence 2:NP_001074463.1 Gene:kctd6a / 100008047 ZFINID:ZDB-GENE-050208-474 Length:237 Species:Danio rerio


Alignment Length:93 Identity:46/93 - (49%)
Similarity:68/93 - (73%) Gaps:1/93 - (1%)


- Green bases have known domain annotations that are detailed below.


  Fly   137 VHIDVGGTIYTSSLETLTKYPESKLAKLFNGQIPIVLDSLKQHYFIDRDGGMFRHILNFMRNSRL 201
            |.::|||.:||:||.||.:||:|.|..:|.|..|...|: :.:|||||||.:||:||||:|.|:|
Zfish    14 VTLNVGGHLYTTSLSTLQRYPDSMLGAMFRGDFPTTRDT-QGNYFIDRDGPLFRYILNFLRTSKL 77

  Fly   202 LIAEDFPDLELLLEEARYYEVEPMIKQL 229
            .:..||.:.|||.:||.:|::||:|:.|
Zfish    78 TLPCDFKETELLRKEADFYQIEPLIQCL 105

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
twzNP_001246449.1 BTB_POZ_KCTD1-like 137..230 CDD:349670 46/93 (49%)
kctd6aNP_001074463.1 BTB 14..104 CDD:197585 45/90 (50%)
BTB 14..102 CDD:295341 44/88 (50%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170591940
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG2723
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
43.740

Return to query results.
Submit another query.