DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Egfr and RYK

DIOPT Version :9

Sequence 1:NP_476759.1 Gene:Egfr / 37455 FlyBaseID:FBgn0003731 Length:1426 Species:Drosophila melanogaster
Sequence 2:NP_001005861.1 Gene:RYK / 6259 HGNCID:10481 Length:610 Species:Homo sapiens


Alignment Length:494 Identity:135/494 - (27%)
Similarity:215/494 - (43%) Gaps:120/494 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly   762 HYKRREQCETECPADHYTDEEQRECFQCHPECNGCTGPGADDCKSCRNFKLFDANETGPYVNSTM 826
            ::|||:.|        |...|:             ....|.|..:.|.  ::|.....|..::.:
Human   187 NFKRRKMC--------YKKLEE-------------VKTSALDKNTSRT--IYDPVHAAPTTSTRV 228

  Fly   827 FNCTSKCPLEMRHVNYQYTAIGPYCAASPPRSSKITANLDVNMIFIITGAVLVPTICILCVVTYI 891
            |                |.::|..||                :||:         :.|:..|.::
Human   229 F----------------YISVGVCCA----------------VIFL---------VAIILAVLHL 252

  Fly   892 CRQKQKAKKETVKMTMALSGCEDSEP-------LR---PSN---IGANL--CKLRIVKDAELR-- 939
            ...|:....:::..:.:..|.  |:|       ||   |:|   |.::|  ..|||.|: :||  
Human   253 HSMKRIELDDSISASSSSQGL--SQPSTQTTQYLRADTPNNATPITSSLGYPTLRIEKN-DLRSV 314

  Fly   940 -----KG---------------GVLGMGAFGRVYKGVWVPEGENVKIPVAIKELLKSTGAE-SSE 983
                 ||               .||..|.|||::.|:.:.|.:..|...|..:.:|...:| ...
Human   315 TLLEAKGKVKDIAISRERITLKDVLQEGTFGRIFHGILIDEKDPNKEKQAFVKTVKDQASEIQVT 379

  Fly   984 EFLREAYIMASVEHVNLLKLLAVCM--SSQMMLITQLMPLGCLLDYVR-------NNRDKIGSKA 1039
            ..|.|:..:..:.|.|||.:..||:  ..:.|:|...|..|.|..::|       ||...|..:.
Human   380 MMLTESCKLRGLHHRNLLPITHVCIEEGEKPMVILPYMNWGNLKLFLRQCKLVEANNPQAISQQD 444

  Fly  1040 LLNWSTQIAKGMSYLEEKRLVHRDLAARNVLVQTPSLVKITDFGLAK-LLSSDSNEYKAAGG--K 1101
            |::.:.|||.|||||..:.::|:||||||.::.....|||||..|:: |...|   |...|.  .
Human   445 LVHMAIQIACGMSYLARREVIHKDLAARNCVIDDTLQVKITDNALSRDLFPMD---YHCLGDNEN 506

  Fly  1102 MPIKWLALECIRNRVFTSKSDVWAFGVTIWELLTFGQRPHENIPAKDIPDLIEVGLKLEQPEICS 1166
            .|::|:|||.:.|..|:|.|||||||||:|||:|.||.|:.:|...::...::.|.::.||..|.
Human   507 RPVRWMALESLVNNEFSSASDVWAFGVTLWELMTLGQTPYVDIDPFEMAAYLKDGYRIAQPINCP 571

  Fly  1167 LDIYCTLLSCWHLDAAMRPTFKQLTTVFAEFARDPGRYL 1205
            .:::..:..||.||...||.|:||.....||....|.|:
Human   572 DELFAVMACCWALDPEERPKFQQLVQCLTEFHAALGAYV 610

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
EgfrNP_476759.1 Recep_L_domain 419..547 CDD:279382
GF_recep_IV 572..684 CDD:291509
FU 573..>606 CDD:238021
FU 617..659 CDD:214589
FU 662..716 CDD:214589
FU 739..786 CDD:238021 6/23 (26%)
FU 784..834 CDD:214589 6/49 (12%)
PTKc_EGFR_like 930..1208 CDD:270648 105/311 (34%)
STYKc 938..1194 CDD:214568 97/290 (33%)
Recep_L_domain 128..239 CDD:279382
Furin-like 253..401 CDD:279142
FU 255..292 CDD:214589
FU 302..345 CDD:238021
RYKNP_001005861.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..20
WIF 63..196 CDD:128745 4/16 (25%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 266..290 5/25 (20%)
PTK_Ryk 326..606 CDD:270639 95/282 (34%)
Pkinase_Tyr 333..599 CDD:285015 93/268 (35%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1025
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.