DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Egfr and Cad96Ca

DIOPT Version :9

Sequence 1:NP_476759.1 Gene:Egfr / 37455 FlyBaseID:FBgn0003731 Length:1426 Species:Drosophila melanogaster
Sequence 2:NP_651349.1 Gene:Cad96Ca / 43026 FlyBaseID:FBgn0022800 Length:773 Species:Drosophila melanogaster


Alignment Length:303 Identity:97/303 - (32%)
Similarity:160/303 - (52%) Gaps:39/303 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly   943 VLGMGAFGRVYKGVWVPEGENVK-----IPVAIKELLKSTGAESSEEFLREAYIMASVE-HVNLL 1001
            :||.||||:    ||..|..|:.     ..||:|.|.:|......::.|.|..:|.|:| |:|::
  Fly   475 ILGEGAFGQ----VWRCEATNINGNEGITTVAVKTLKESATEVDRKDLLSELEVMKSLEPHINVV 535

  Fly  1002 KLLAVCMSSQ-MMLITQLMPLGCLLDYVRNNR------------DKIGSKALLNWSTQIAKGMSY 1053
            .||..|.... ..:|.:.:..|.|..|:|::|            :.:.|..|.::..|:||||.|
  Fly   536 HLLGCCTDKDPTFVILEYVNRGKLQTYLRSSRAERHYGNTHGKSNVLTSCDLTSFMYQVAKGMDY 600

  Fly  1054 LEEKRLVHRDLAARNVLVQTPSLVKITDFGLAK-LLSSDSNEYKAAGGKMPIKWLALECIRNRVF 1117
            |..:.::||||||||:|:......|:.|||.|: :::|...|.|:. ||:||:|:|.|.:.:.:|
  Fly   601 LTSRGIIHRDLAARNILITDDHTCKVADFGFARDVITSKIYERKSE-GKLPIRWMATESLYDNIF 664

  Fly  1118 TSKSDVWAFGVTIWELLTFGQRPHENIPAKDIPDLIEVGLKLEQPEICSLDIYCTLLSCWHLDAA 1182
            :.|||:|:||:.:||::|.|..|:..|.|.|:...:..|.:||:||.|..::|..:..||..|..
  Fly   665 SVKSDIWSFGILMWEIVTLGSTPYPGISAADVMRKVRDGYRLEKPEHCRRELYNIMYYCWSHDPQ 729

  Fly  1183 MRPTFKQLTTV----------FAEFARDPG----RYLAIPGDK 1211
            .||.|.::..:          :.|..|.|.    ..:::.|:|
  Fly   730 ERPLFAEIIQMLDKLLHTEMDYIELERFPDHNYYNIVSLSGEK 772

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
EgfrNP_476759.1 Recep_L_domain 419..547 CDD:279382
GF_recep_IV 572..684 CDD:291509
FU 573..>606 CDD:238021
FU 617..659 CDD:214589
FU 662..716 CDD:214589
FU 739..786 CDD:238021
FU 784..834 CDD:214589
PTKc_EGFR_like 930..1208 CDD:270648 95/298 (32%)
STYKc 938..1194 CDD:214568 92/280 (33%)
Recep_L_domain 128..239 CDD:279382
Furin-like 253..401 CDD:279142
FU 255..292 CDD:214589
FU 302..345 CDD:238021
Cad96CaNP_651349.1 Cadherin_repeat 65..164 CDD:206637
STYKc 470..741 CDD:214568 92/270 (34%)
PTKc 474..742 CDD:270623 92/271 (34%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45455331
Domainoid 1 1.000 165 1.000 Domainoid score I1208
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24416
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
43.940

Return to query results.
Submit another query.