DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Egfr and Ack-like

DIOPT Version :9

Sequence 1:NP_476759.1 Gene:Egfr / 37455 FlyBaseID:FBgn0003731 Length:1426 Species:Drosophila melanogaster
Sequence 2:NP_001260935.1 Gene:Ack-like / 36442 FlyBaseID:FBgn0263998 Length:1495 Species:Drosophila melanogaster


Alignment Length:301 Identity:111/301 - (36%)
Similarity:164/301 - (54%) Gaps:32/301 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly   944 LGMGAFGRVYKGVWVPEGENVKIPVAIKELLKSTGAESSEEFLREAYIMASVEHVNLLKLLAVCM 1008
            ||.|.||.|.:|||  ...|.:|.||||.|.:.....:..|||:||.||.|:||.|:::|..|.:
  Fly   139 LGTGEFGIVQQGVW--SNGNERIQVAIKCLCRERMQSNPMEFLKEAAIMHSIEHENIVRLYGVVL 201

  Fly  1009 SS-QMMLITQLMPLGCLLDYVRNNRDKIG---SKALLNWSTQIAKGMSYLEEKRLVHRDLAARNV 1069
            :: .:||:|:|..|..||:.::::..::.   ...|..::.||..||.|||:|||:||||||||:
  Fly   202 ATDSLMLVTELAHLRSLLECLKDSGLRVSFLTIPTLCEFALQICNGMRYLEQKRLIHRDLAARNI 266

  Fly  1070 LVQTPSLVKITDFGLAKLLSSDSNEYKA---AGGKMPIKWLALECIRNRVFTSKSDVWAFGVTIW 1131
            ||.:...|||:||||::.|....:.||.   ...|:||.|.|.|||....||:.||||||||.:|
  Fly   267 LVFSKDKVKISDFGLSRALGVGKDYYKTNFNVNLKLPIAWCAPECINYLRFTNASDVWAFGVCLW 331

  Fly  1132 ELLTFGQRPHENIPAKDIPDLIEVG--LKLEQPEICSLDIYCTLLSCWHLDAAMRPTFKQLTTVF 1194
            |:.::|.:|...:....|.:.|:..  .:||||:.|..:.|..::.||..|||.||.|       
  Fly   332 EMFSYGFQPWAALTGLQILEAIDAPNYQRLEQPDCCPSEYYTLMMKCWQDDAAKRPRF------- 389

  Fly  1195 AEFARDPGRYLAIPGDKFTRLPAYTSQDEKDLIRKLAPTTD 1235
                          |:.:.:||....:..|.::....|..|
  Fly   390 --------------GEIYDQLPDMKPEQLKAVVNCTEPKKD 416

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
EgfrNP_476759.1 Recep_L_domain 419..547 CDD:279382
GF_recep_IV 572..684 CDD:291509
FU 573..>606 CDD:238021
FU 617..659 CDD:214589
FU 662..716 CDD:214589
FU 739..786 CDD:238021
FU 784..834 CDD:214589
PTKc_EGFR_like 930..1208 CDD:270648 105/272 (39%)
STYKc 938..1194 CDD:214568 105/258 (41%)
Recep_L_domain 128..239 CDD:279382
Furin-like 253..401 CDD:279142
FU 255..292 CDD:214589
FU 302..345 CDD:238021
Ack-likeNP_001260935.1 SAM_TNK-like 4..65 CDD:188938
STYKc 133..396 CDD:214568 106/279 (38%)
PTKc_Ack_like 137..398 CDD:270636 107/281 (38%)
SH3 400..454 CDD:214620 3/17 (18%)
CRIB 486..525 CDD:238077
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.