DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Egfr and Drl-2

DIOPT Version :9

Sequence 1:NP_476759.1 Gene:Egfr / 37455 FlyBaseID:FBgn0003731 Length:1426 Species:Drosophila melanogaster
Sequence 2:NP_001286371.1 Gene:Drl-2 / 36436 FlyBaseID:FBgn0033791 Length:648 Species:Drosophila melanogaster


Alignment Length:443 Identity:116/443 - (26%)
Similarity:198/443 - (44%) Gaps:93/443 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly   801 ADDCKSCRNFKLFDANET-GPYVNS-----------TMFN-CTSKCPLEMRHVNYQYTAIGPYCA 852
            ||..|||..|..|.::.| .||..:           |::: ..|.||..:.:  |..:.:...|:
  Fly   261 ADSKKSCSIFDRFRSSPTPTPYATALLPMNLEQTAETIYSKPESICPSRISY--YASSQLTQPCS 323

  Fly   853 ASPPRSSKITANLDVN------MIF--IITGAVLVPTICILCVVTYICRQKQKAKKETVKMTMAL 909
            .|.|:|.:...|.:..      .:|  |.||:.:                           |||.
  Fly   324 LSTPKSIRSNGNGNCTSGSGSLSLFGGIPTGSTI---------------------------TMAS 361

  Fly   910 SGCEDSEPLRPSNIGANLCKLRIVKDAELRKGGVLGMGAFGRVYKGVWVPEGENVKIPVAIKELL 974
            .|.:.::.||         ::..|:...|....::..|.|||:|.|         |:..:.:.|:
  Fly   362 HGEKGNQRLR---------RITSVQPGALSYEELVKEGTFGRIYAG---------KLGESCEALV 408

  Fly   975 KST--GAESSEE--FLREAYIMASVEHVNLLKLLAVCMSSQMMLITQL----------MPLGCLL 1025
            |:.  ||..::.  .|::|.::..|.|.::|        :.::..|:|          ...|.|.
  Fly   409 KTVIDGASLTQVACLLQDASLLIGVSHQHIL--------APLLANTELPGPPEIAYPHPSKGNLK 465

  Fly  1026 DYVRNNRDK---IGSKALLNWSTQIAKGMSYLEEKRLVHRDLAARNVLVQTPSLVKITDFGLAKL 1087
            .|::.:|:.   :.::.|:.:...|.||::||....:||:|:|.||..:...|.|||.|..|::.
  Fly   466 MYLQKSRESSTALSTRQLVEFGLHITKGLAYLHSLGIVHKDIATRNCYLDEESYVKICDSALSRD 530

  Fly  1088 LSSDSNEYKAAGGKMPIKWLALECIRNRVFTSKSDVWAFGVTIWELLTFGQRPHENIPAKDIPDL 1152
            |..|..:........|:|||:||.::.||:.::.||||.|||.|||:|..|.|||.:...::.:.
  Fly   531 LFPDDYDCLGDNENRPLKWLSLESLQKRVYATQGDVWALGVTYWELVTLAQMPHEEVDIFELTNY 595

  Fly  1153 IEVGLKLEQPEICSLDIYCTLLSCWHLDAAMRPTFKQLTTVFAEFARDPGRYL 1205
            :..|.:||||..|..:.:..:..|||.:|..|||..||.:...:|..|.|.|:
  Fly   596 LAAGFRLEQPVNCPDEFFTVMNCCWHCEAKQRPTPSQLLSYLQDFHADLGMYI 648

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
EgfrNP_476759.1 Recep_L_domain 419..547 CDD:279382
GF_recep_IV 572..684 CDD:291509
FU 573..>606 CDD:238021
FU 617..659 CDD:214589
FU 662..716 CDD:214589
FU 739..786 CDD:238021
FU 784..834 CDD:214589 12/45 (27%)
PTKc_EGFR_like 930..1208 CDD:270648 86/293 (29%)
STYKc 938..1194 CDD:214568 81/272 (30%)
Recep_L_domain 128..239 CDD:279382
Furin-like 253..401 CDD:279142
FU 255..292 CDD:214589
FU 302..345 CDD:238021
Drl-2NP_001286371.1 WIF 37..156 CDD:280237
PTK_Ryk 373..644 CDD:270639 83/287 (29%)
STYKc 389..637 CDD:214568 80/264 (30%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1025
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24416
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.910

Return to query results.
Submit another query.