DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Egfr and tor

DIOPT Version :9

Sequence 1:NP_476759.1 Gene:Egfr / 37455 FlyBaseID:FBgn0003731 Length:1426 Species:Drosophila melanogaster
Sequence 2:NP_476762.1 Gene:tor / 35717 FlyBaseID:FBgn0003733 Length:923 Species:Drosophila melanogaster


Alignment Length:554 Identity:137/554 - (24%)
Similarity:222/554 - (40%) Gaps:200/554 - (36%)


- Green bases have known domain annotations that are detailed below.


  Fly   868 NMIFIITGAVLVPTICI--LCVVTYICRQKQKAKKETVKMTMALSGCEDSE---PLRPSN----- 922
            ||:.::. .::||..||  ||.:|: ||:.   :.|...:.|.....:.||   .|..|:     
  Fly   396 NMVKLVL-FIIVPICCILMLCSLTF-CRRN---RSEVQALQMDAKDAKASEFHLSLMDSSGLLVT 455

  Fly   923 IGANLCKLRIVKDAELRKGG-----VLGMGAFGRVYKGVWVPEGENVKIPVAIKELLKSTGAESS 982
            :.||. .|.::.:.|:....     |||.||||.|.:||:      .|..||:|.|......|..
  Fly   456 LSANE-SLEVMDELEVEPHSVLLQDVLGEGAFGLVRRGVY------KKRQVAVKLLKDEPNDEDV 513

  Fly   983 EEFLREAYIMASV-EHVNLLKLL--AVCMSSQMMLITQLMPLGCLLDYVR--------------- 1029
            ..|..|..::.:| :|.|::.::  :...|:||||:.:...||.|.:::|               
  Fly   514 YAFKCEIQMLKAVGKHPNIVGIVGYSTRFSNQMMLLIEYCSLGSLQNFLREEWKFRQEQNAIGLK 578

  Fly  1030 -------NNR------------------------------------------------------- 1032
                   :||                                                       
  Fly   579 KNLEQNVDNRRFNRLPRNSIHDRIEDINNSMLSTVEEESESDQTHSSRCETYTLTRITNAADNKG 643

  Fly  1033 ------DKIG--------------------------SKA-------------------------- 1039
                  :.||                          ||.                          
  Fly   644 YGLEDIENIGGSYIPKTAEAPKDRPKRKLKPQPKKDSKQDFKSDNKKRIFENKEYFDCLDSSDTK 708

  Fly  1040 ---------LLNWSTQIAKGMSYLEEKRLVHRDLAARNVLVQTPSLVKITDFGLAKLLSSDSNEY 1095
                     ||:.:.|:|.||.:|.:.::|||||||||||:.....:||.||||::.:..: |.|
  Fly   709 PRIPLKYADLLDIAQQVAVGMEFLAQNKVVHRDLAARNVLISVDRSIKIADFGLSRDVYHE-NVY 772

  Fly  1096 KAAG--GKMPIKWLALECIRNRVFTSKSDVWAFGVTIWELLTFGQRPHENIPAKDIPDLIEVGLK 1158
            :.:|  ||:||||||||.:.::|:||:||||:|||.::|:.|.|..|:.::...|:..|:..|.:
  Fly   773 RKSGGSGKLPIKWLALESLTHQVYTSQSDVWSFGVLLYEITTLGGMPYPSVSPSDLLQLLRQGHR 837

  Fly  1159 LEQPEICSLDIYCTLLSCWHLDAAMRPTFKQLTTVFAEFARDPGRYLA---IPGDKFTRLPAYTS 1220
            :::||.|:.:::..:.|||....:.||||..|.      .|..|..||   :| ::..:|.|.|.
  Fly   838 MKRPEGCTQEMFSLMESCWSSVPSHRPTFSALK------HRLGGMILATNDVP-ERLKQLQAATE 895

  Fly  1221 QDEKDLIRKLAPTTDG-----SEAIAEPDDYLQP 1249
            ...|        :.||     .:...|.:.||:|
  Fly   896 SKLK--------SCDGLNSKVEQVPCEEELYLEP 921

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
EgfrNP_476759.1 Recep_L_domain 419..547 CDD:279382
GF_recep_IV 572..684 CDD:291509
FU 573..>606 CDD:238021
FU 617..659 CDD:214589
FU 662..716 CDD:214589
FU 739..786 CDD:238021
FU 784..834 CDD:214589
PTKc_EGFR_like 930..1208 CDD:270648 107/434 (25%)
STYKc 938..1194 CDD:214568 101/409 (25%)
Recep_L_domain 128..239 CDD:279382
Furin-like 253..401 CDD:279142
FU 255..292 CDD:214589
FU 302..345 CDD:238021
torNP_476762.1 FN3 199..261 CDD:214495
STYKc 475..873 CDD:214568 101/410 (25%)
PTKc 479..873 CDD:270623 101/406 (25%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24416
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.