DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Egfr and Ddr

DIOPT Version :9

Sequence 1:NP_476759.1 Gene:Egfr / 37455 FlyBaseID:FBgn0003731 Length:1426 Species:Drosophila melanogaster
Sequence 2:NP_001014474.3 Gene:Ddr / 3346209 FlyBaseID:FBgn0053531 Length:1054 Species:Drosophila melanogaster


Alignment Length:452 Identity:117/452 - (25%)
Similarity:188/452 - (41%) Gaps:97/452 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly   791 PEC-NGC-----TGPGADDCKSCRNFKLFDANETGPYVNSTMFNCTSKCPLEMRHVNYQYTAIGP 849
            |.| :||     ||||..   |...|.:.....|....||  .|..: .||....|.   ..:..
  Fly   628 PPCGSGCGTGTGTGPGRG---SSPEFVVATGKVTASARNS--LNAAT-LPLPSPPVP---PPLEK 683

  Fly   850 YCAASP---------PRSSKITANLDVNMIFIITGAVLVPTICILCVVTYICRQKQKAKKETVKM 905
            |.||:|         |..|:.:.:|..:     |.|...||..::.|          .|.....:
  Fly   684 YYAATPVSSKPMPVAPPGSQSSGSLSSS-----TTAATTPTSGVVGV----------GKPHHYNL 733

  Fly   906 TMAL---------SGCEDSEPLRPSNIGANLCKLRIVKDAELRKGGVLGMGAFGRVYKGVWVPEG 961
            .|:.         :.|:..|..|.|        |.||:.        ||.|.||.::  :.....
  Fly   734 DMSANFADINEERANCQVQEFPRQS--------LVIVEK--------LGSGVFGELH--LCETNV 780

  Fly   962 ENVKIPVAIKELLKSTGAESSEEFLREAYIMASVEHVNLLKLLAVCMSSQMMLITQLMP--LGCL 1024
            .|..: ||:..|.........:||..:|..:|.:...|:.:|:..|:..:.:.|.|...  ||.|
  Fly   781 LNATL-VAVATLRPGANDHLRKEFRSKAKQLAQLSDPNVARLVGACLRDEPICIVQDYSHCLGDL 844

  Fly  1025 LDYVRNN---------RDKIGSKALLNWSTQIAKGMSYLEEKRLVHRDLAARNVLVQTPSLVKIT 1080
            ..:::.:         :..:....|:..:||||.||.:||:...||||||.|:.::.....||:.
  Fly   845 NQFLQEHVAETSGLMAKKSLSFGCLVYIATQIASGMKHLEQMNFVHRDLATRSCIIGPELCVKVC 909

  Fly  1081 DFGLAKLLSSDSNEYKAAGG-------KMPIKWLALECIRNRVFTSKSDVWAFGVTIWELLTFG- 1137
            ..|.....|:.:::|....|       .|||:|:|.|.:....||:|||||:|.|.:||:|||. 
  Fly   910 SIGTVINRSAYASDYCQLEGFTGRQSQPMPIRWMAWESVLLGKFTTKSDVWSFAVALWEILTFAR 974

  Fly  1138 QRPHENIPAKDIPDLIEVGL---------KLEQPEICSLDIYCTLLSCWHLDAAMRPTFKQL 1190
            ::|:|::..|.:  :..:||         .|..|..|..:||..:..||..|.:.||:|:::
  Fly   975 EQPYEHLSDKSV--IENIGLIYRDYKMHELLPMPPNCPREIYDLMCECWQRDESSRPSFREI 1034

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
EgfrNP_476759.1 Recep_L_domain 419..547 CDD:279382
GF_recep_IV 572..684 CDD:291509
FU 573..>606 CDD:238021
FU 617..659 CDD:214589
FU 662..716 CDD:214589
FU 739..786 CDD:238021
FU 784..834 CDD:214589 14/48 (29%)
PTKc_EGFR_like 930..1208 CDD:270648 82/289 (28%)
STYKc 938..1194 CDD:214568 79/281 (28%)
Recep_L_domain 128..239 CDD:279382
Furin-like 253..401 CDD:279142
FU 255..292 CDD:214589
FU 302..345 CDD:238021
DdrNP_001014474.3 FA58C 106..262 CDD:214572
FA58C 109..261 CDD:238014
PTKc_DDR 753..1040 CDD:270644 85/303 (28%)
TyrKc 759..1038 CDD:197581 82/289 (28%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45455258
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24416
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.030

Return to query results.
Submit another query.