DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Egfr and gcy-14

DIOPT Version :9

Sequence 1:NP_476759.1 Gene:Egfr / 37455 FlyBaseID:FBgn0003731 Length:1426 Species:Drosophila melanogaster
Sequence 2:NP_506660.2 Gene:gcy-14 / 191647 WormBaseID:WBGene00001540 Length:1111 Species:Caenorhabditis elegans


Alignment Length:281 Identity:69/281 - (24%)
Similarity:122/281 - (43%) Gaps:36/281 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly   966 IPVAIK-ELLKSTGAESSEEFLREAYIMASVEHVNLLKLLAVCMSS-QMMLITQLMPLGCLLDYV 1028
            |..|:| :|:....||...||.:    |.:.::.||.|.:.:|:.. |:..:.:....|.|.|.:
 Worm   566 ILAAMKHDLILQFDAEQKAEFRQ----MRNFDNDNLNKFIGLCLDGPQLFSLWRFCSRGSLSDVI 626

  Fly  1029 RNNRDKIGSKALLNWSTQIAKGMSYLEEKRL-VHRDLAARNVLVQTPSLVKITDFGLAKLLSSDS 1092
            ..:..::.|..:.:....|:.|:.::....| .|..|.:|..|:.....:||:.:||..:.:.::
 Worm   627 SKSSMQMDSFFMFSLIRDISNGLLFIHNSFLKCHGHLTSRCCLIDDRWQIKISGYGLKSVRTFEN 691

  Fly  1093 NEYKAAGGKMPIKWLALECIRN----RVFTSKSDVWAFGVTIWELLTFGQR-PHENIPAKDIPDL 1152
            .:      |..:.|...|.:||    |:  .:.|:::||:...|:||.... ..||  .|:.||:
 Worm   692 PK------KEDLLWTPPENLRNENEERL--PEGDIYSFGIICSEILTRSSAFDLEN--RKEKPDV 746

  Fly  1153 IEVGLKL--EQPEICSLD------IYCTLL----SCWHLDAAMRPTFKQLTTVFAEFARDPGRYL 1205
            |...:|.  ..|...|||      |...||    .||....:.||:.:|:.. .....|| ||..
 Worm   747 IIYQVKKGGHNPMRPSLDTGETVEINPALLHLIRDCWTERPSERPSIEQVRG-HLNGMRD-GRKS 809

  Fly  1206 AIPGDKFTRLPAYTSQDEKDL 1226
            .:....|..|..|.|..|:::
 Worm   810 NLMDHVFNMLETYASTLEEEV 830

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
EgfrNP_476759.1 Recep_L_domain 419..547 CDD:279382
GF_recep_IV 572..684 CDD:291509
FU 573..>606 CDD:238021
FU 617..659 CDD:214589
FU 662..716 CDD:214589
FU 739..786 CDD:238021
FU 784..834 CDD:214589
PTKc_EGFR_like 930..1208 CDD:270648 64/261 (25%)
STYKc 938..1194 CDD:214568 60/247 (24%)
Recep_L_domain 128..239 CDD:279382
Furin-like 253..401 CDD:279142
FU 255..292 CDD:214589
FU 302..345 CDD:238021
gcy-14NP_506660.2 PBP1_NPR_GC_like 21..423 CDD:107347
ANF_receptor 43..418 CDD:279440
PKc_like 535..800 CDD:304357 60/248 (24%)
HNOBA <817..860 CDD:285003 4/14 (29%)
CYCc 839..1031 CDD:214485
Guanylate_cyc 866..1053 CDD:278633
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.