DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG30283 and Prss1l

DIOPT Version :10

Sequence 1:NP_611587.2 Gene:CG30283 / 37454 FlyBaseID:FBgn0260477 Length:273 Species:Drosophila melanogaster
Sequence 2:NP_001034086.1 Gene:Prss1l / 436523 MGIID:3646222 Length:245 Species:Mus musculus


Alignment Length:126 Identity:29/126 - (23%)
Similarity:48/126 - (38%) Gaps:23/126 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly    91 IISATHCTIGMEPANLNVYVGSVK-----LASGGV-----YYRTMRIVNHPLYDPNTIENDISLI 145
            ::|.:|..: |:|:..|...|:..     .|:|||     |.:..|.......|....|..:|.:
Mouse   455 VVSDSHAVL-MKPSAENCQHGTPSHRGRLNATGGVHQLNDYLKNSREAQGSNRDSPYSERYVSAM 518

  Fly   146 QTVQPIVFNEHTQPIGLASTNLISATGASISGWGRSNVILDNLQYMNVNILTMEECRAERP 206
            .|...:      .|:||.|....|:..:.:|      ..|.:|.....::||......|||
Mouse   519 TTPTRL------SPVGLLSPVTPSSPPSEMS------APLSSLATSVPSMLTSPSGEEERP 567

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG30283NP_611587.2 Tryp_SPc 42..263 CDD:214473 29/126 (23%)
Prss1lNP_001034086.1 Tryp_SPc 23..241 CDD:238113
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.