DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG30283 and Jon99Cii

DIOPT Version :9

Sequence 1:NP_611587.2 Gene:CG30283 / 37454 FlyBaseID:FBgn0260477 Length:273 Species:Drosophila melanogaster
Sequence 2:NP_524554.1 Gene:Jon99Cii / 43544 FlyBaseID:FBgn0003356 Length:265 Species:Drosophila melanogaster


Alignment Length:291 Identity:82/291 - (28%)
Similarity:126/291 - (43%) Gaps:67/291 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 KIFVVVVLLAASSVVVLGSESGSFLEHPCGT-----VPIS--QFKILGGHNAPVASAPWMA--MV 60
            |:||.:.|..|::..|           |...     .||.  |.:|..|:.|.....|::.  :.
  Fly     2 KLFVFLALAVAAATAV-----------PAPAQKLTPTPIKDIQGRITNGYPAYEGKVPYIVGLLF 55

  Fly    61 MGEGGFHCGGTLITNRFVLTSAHCIANGELKVRLGVLEREAEAQKFAVDAMFVHTDYYFDQHDLA 125
            .|.|.:.|||::|.|.:|||:||| .||...|.:..      .........:.|   :....|  
  Fly    56 SGNGNWWCGGSIIGNTWVLTAAHC-TNGASGVTINY------GASIRTQPQYTH---WVGSGD-- 108

  Fly   126 LLRLAKRVHY-SDNI-SPICLLLDP------LVKNID--EHIVKFRTY--------GWGKTESRS 172
               :.:..|| |.|: :.|.|:..|      ||..::  .:..:::.|        |||.|...|
  Fly   109 ---IIQHHHYNSGNLHNDISLIRTPHVDFWSLVNKVELPSYNDRYQDYAGWWAVASGWGGTYDGS 170

  Fly   173 S-SRMLQKTSLFNLHRSECAKQYPHQQINRNHICAES-ANANTCNGDSGGPLTAIVTYDHVQMVF 235
            . ...||...:..:.:|:|::.:   .::.|.||..: ...:||.|||||||   ||:|..::| 
  Fly   171 PLPDWLQSVDVQIISQSDCSRTW---SLHDNMICINTDGGKSTCGGDSGGPL---VTHDGNRLV- 228

  Fly   236 QFGVTSFGH-ADCSKA--TVFTNVMTHLDWI 263
              ||||||. |.|...  .||:.|..:||||
  Fly   229 --GVTSFGSAAGCQSGAPAVFSRVTGYLDWI 257

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG30283NP_611587.2 Tryp_SPc 42..263 CDD:214473 70/245 (29%)
Tryp_SPc 43..266 CDD:238113 72/246 (29%)
Jon99CiiNP_524554.1 Tryp_SPc 36..260 CDD:238113 72/246 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.