DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG30283 and CG11843

DIOPT Version :9

Sequence 1:NP_611587.2 Gene:CG30283 / 37454 FlyBaseID:FBgn0260477 Length:273 Species:Drosophila melanogaster
Sequence 2:NP_001287578.1 Gene:CG11843 / 43432 FlyBaseID:FBgn0039630 Length:316 Species:Drosophila melanogaster


Alignment Length:256 Identity:82/256 - (32%)
Similarity:112/256 - (43%) Gaps:41/256 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly    43 ILGGHNAPVASAPWMAMV------MGEGGFHCGGTLITNRFVLTSAHCIAN--GELK-VRLG--- 95
            |:|||.|.....|.||.:      .....:.|||.||:.|||||:|||:.:  ||:. ||||   
  Fly    68 IVGGHPAQPREFPHMARLGRRPDPSSRADWFCGGVLISERFVLTAAHCLESERGEVNVVRLGELD 132

  Fly    96 --VLEREAEAQKFAVDAMFVHTDYYFDQ--HDLALLRLAKRVHYSDNISPICLLLDPLVKNIDEH 156
              .|:.:|..:.:.|.....|..|...|  ||:.|::|.:.|.:.....|.||...      ||.
  Fly   133 FDSLDEDAAPRDYMVAGYIAHPGYEDPQFYHDIGLVKLTEAVVFDLYKHPACLPFQ------DER 191

  Fly   157 IV-KFRTYGWGKTE-SRSSSRMLQKTSLFNLHRSECAK-------QYPHQQINRNHICAESANA- 211
            .. .|...|||.|. :...|..|.|..|.......|.|       ::|......|.:|..|..| 
  Fly   192 SSDSFIAVGWGSTGLALKPSAQLLKVKLQRYGNWVCKKLLTRQVEEFPRGFDGNNQLCVGSEMAQ 256

  Fly   212 NTCNGDSGGPLTAIVTY--DHVQMVFQFGVTSFGHADCSK---ATVFTNVMTHLDWIVNTV 267
            :||||||||||   :.|  ::..|....|:||.| ..|..   ..::|.|..:|.||..|:
  Fly   257 DTCNGDSGGPL---LMYHREYPCMYVVVGITSAG-LSCGSPGIPGIYTRVYPYLGWIARTL 313

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG30283NP_611587.2 Tryp_SPc 42..263 CDD:214473 79/250 (32%)
Tryp_SPc 43..266 CDD:238113 81/253 (32%)
CG11843NP_001287578.1 Tryp_SPc 68..312 CDD:238113 81/253 (32%)
Tryp_SPc 68..309 CDD:214473 79/250 (32%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.