DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG30283 and CG11842

DIOPT Version :9

Sequence 1:NP_611587.2 Gene:CG30283 / 37454 FlyBaseID:FBgn0260477 Length:273 Species:Drosophila melanogaster
Sequence 2:NP_651662.1 Gene:CG11842 / 43431 FlyBaseID:FBgn0039629 Length:319 Species:Drosophila melanogaster


Alignment Length:254 Identity:82/254 - (32%)
Similarity:121/254 - (47%) Gaps:47/254 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly    43 ILGGHNAPVASAPWMAMV-----MGEGGFHCGGTLITNRFVLTSAHC--IANGELKV-RLGVLE- 98
            |:||..|.....|..|.:     .||..:.||||||::|.|||:|||  ...|.:.: |||.|| 
  Fly    73 IIGGGPAVPKEFPHAARLGHKDENGEVEWFCGGTLISDRHVLTAAHCHYSPQGSVNIARLGDLEF 137

  Fly    99 ----REAEAQKFAVDAMFVHTDYYFD--QHDLALLRLAKRVHYSDNISPICLLLDPLVKNIDEHI 157
                .:|:.:.|.|.....|.::.:.  .:|::::||::.|.::|...|.||..|      |..:
  Fly   138 DTNNDDADPEDFDVKDFTAHPEFSYPAIYNDISVVRLSRPVTFNDYKHPACLPFD------DGRL 196

  Fly   158 -VKFRTYGWGKTE--SRSSSRMLQKTSLFNLHRSECAKQYPHQQINRNHICAESANA-------- 211
             ..|...|||:.|  .|:.::.|||..|:| :.:.|     ....:||....|..||        
  Fly   197 GTSFIAIGWGQLEIVPRTENKKLQKVKLYN-YGTRC-----RITADRNDELPEGYNATTQLCIGS 255

  Fly   212 ----NTCNGDSGGPLTAIVTYDHVQMVFQFGVTSFGHADCSK---ATVFTNVMTHLDWI 263
                :|||||||||: .|...|:..|....|:||.|.| |..   ..::|.|..:||||
  Fly   256 NEHKDTCNGDSGGPV-LIYHMDYPCMYHVMGITSIGVA-CDTPDLPAMYTRVHFYLDWI 312

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG30283NP_611587.2 Tryp_SPc 42..263 CDD:214473 80/252 (32%)
Tryp_SPc 43..266 CDD:238113 82/254 (32%)
CG11842NP_651662.1 Tryp_SPc 73..315 CDD:238113 82/254 (32%)
Tryp_SPc 73..312 CDD:214473 80/252 (32%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.