DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG30283 and CG4815

DIOPT Version :9

Sequence 1:NP_611587.2 Gene:CG30283 / 37454 FlyBaseID:FBgn0260477 Length:273 Species:Drosophila melanogaster
Sequence 2:NP_651607.1 Gene:CG4815 / 43360 FlyBaseID:FBgn0039568 Length:265 Species:Drosophila melanogaster


Alignment Length:299 Identity:71/299 - (23%)
Similarity:108/299 - (36%) Gaps:80/299 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly     8 VVVVLLAASSVVVLGSESGSFLE-----HPCGTVPISQFKILGGHNAPVASAPWMAMVMGEG-GF 66
            :|.:||..:||   .:|:|:..|     ||         :|..|....|.|...:.:.:..| ..
  Fly     7 LVRLLLILNSV---RTEAGNREEWTGRFHP---------RIYNGIKTTVESLGGVGIQLFNGRKL 59

  Fly    67 HCGGTLITNRFVLTSAHCIAN-------------GELK-----------VRLGVLEREAEAQKFA 107
            .|..||:|.|.:||:|||..|             .|..           :|:.:..:.|: .||.
  Fly    60 VCSATLLTPRHILTAAHCFENLNRSKFHVIGGKSAEFTWHGNNFNKNKLIRVQIHPKYAK-MKFI 123

  Fly   108 VDAMFVHTDYYFDQHDLALLRLAKRV-HYSDNISPICLLLDPLVKNIDEHIVKFRTYGWG----- 166
            .|.....|.|......:...:|.:.| |..|                     |....|||     
  Fly   124 ADVAVAKTKYPLRSKYIGYAQLCRSVLHPRD---------------------KLIAAGWGFEGGV 167

  Fly   167 KTESRSSSRMLQKTSLFNLHRSECAKQYPHQQINRNHICAESANANT-CNGDSGGPLTAIVTYDH 230
            ..|||..:....|..:  :.:.:|.||. .:::..|.|||.:.|..| |.|||||||..      
  Fly   168 WDESRKKTFRSMKVGI--VSKRDCEKQL-DRKMPPNIICAGAYNNKTLCFGDSGGPLLL------ 223

  Fly   231 VQMVFQFGVTSFGHADCSKATVFTNVMTHLDWIVNTVRR 269
            .:.|......:|...:..|..|:..|..:..:|..|:.|
  Fly   224 GRQVCGINTWTFKCGNNEKPDVYMGVRYYAKFIKRTINR 262

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG30283NP_611587.2 Tryp_SPc 42..263 CDD:214473 58/252 (23%)
Tryp_SPc 43..266 CDD:238113 59/254 (23%)
CG4815NP_651607.1 Tryp_SPc 49..259 CDD:304450 55/240 (23%)
Trypsin 49..256 CDD:278516 54/237 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.