DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG30283 and CG5909

DIOPT Version :9

Sequence 1:NP_611587.2 Gene:CG30283 / 37454 FlyBaseID:FBgn0260477 Length:273 Species:Drosophila melanogaster
Sequence 2:NP_651544.1 Gene:CG5909 / 43274 FlyBaseID:FBgn0039495 Length:381 Species:Drosophila melanogaster


Alignment Length:254 Identity:78/254 - (30%)
Similarity:128/254 - (50%) Gaps:28/254 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly    42 KILGGHNAPVASAPWMAM----VMGEGGFHCGGTLITNRFVLTSAHCIANGE--LKVRLGVLERE 100
            |:.||..|.....||:|:    :.....|.|||:||:.|.:||:||||.:..  :.||||..:.|
  Fly   129 KVSGGKTARPGDFPWVALLKYKINDPRPFRCGGSLISERHILTAAHCIIDQPEVIAVRLGEHDLE 193

  Fly   101 AEA----------------QKFAVDAMFVHTDYYFDQ--HDLALLRLAKRVHYSDNISPICLLLD 147
            :|.                :::.::.:.||.:|...:  ||:|:::|.:.|....:|.|:||.:|
  Fly   194 SEEDCHYLGGTNRVCIPPYEEYGIEQIRVHPNYVHGKISHDVAIIKLDRVVKEKSHIKPVCLPID 258

  Fly   148 PLVKNIDEHIVKFRTYGWGKTESRSSSRMLQKTSLFNLHRSECAKQYPHQQINRNHICAESAN-A 211
            ...:.:| ....|...|||.||..:.:..||:..:.....:||.:.|...:::.|||||.... .
  Fly   259 QKSQELD-FDQSFFVAGWGGTEKETVATKLQQALITRKSLNECRQYYNKGEVSDNHICATGTGIK 322

  Fly   212 NTCNGDSGGPLTAIVTYDHVQMVFQFGVTSFGHADC--SKATVFTNVMTHLDWIVNTVR 268
            :||.||||||:.....:.:...|.|:||.|||...|  ::..||.:|:..|.||...::
  Fly   323 HTCQGDSGGPVFFKHRFKNTYRVVQYGVVSFGGRLCGQNQPGVFASVIDMLPWITQNLQ 381

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG30283NP_611587.2 Tryp_SPc 42..263 CDD:214473 76/247 (31%)
Tryp_SPc 43..266 CDD:238113 77/249 (31%)
CG5909NP_651544.1 CLIP 25..82 CDD:197829
Tryp_SPc 129..376 CDD:214473 76/247 (31%)
Tryp_SPc 132..379 CDD:238113 77/247 (31%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 102 1.000 Domainoid score I4289
eggNOG 1 0.900 - - E33208_3BQ4K
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.900

Return to query results.
Submit another query.