DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG30283 and CG10232

DIOPT Version :9

Sequence 1:NP_611587.2 Gene:CG30283 / 37454 FlyBaseID:FBgn0260477 Length:273 Species:Drosophila melanogaster
Sequence 2:NP_651175.4 Gene:CG10232 / 42800 FlyBaseID:FBgn0039108 Length:509 Species:Drosophila melanogaster


Alignment Length:280 Identity:84/280 - (30%)
Similarity:126/280 - (45%) Gaps:55/280 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly    24 ESGSFLEHPCGTVPISQFKILGGHNAPVASAPWMAMVMGEG------GFHCGGTLITNRFVLTSA 82
            |.|:.|...||..| ..:::..|..|.....|||||::.|.      ..:|.|:||..|:|||:|
  Fly   239 EPGNVLPTSCGQAP-PLYRMAYGTAARPNEYPWMAMLIYENRRLSTMTNNCSGSLINKRYVLTAA 302

  Fly    83 HCIANGEL--------KVRLGVLERE--------------AEAQKFAVDAMFVHTDYY----FDQ 121
            ||:...::        :||||  |.:              |...:..::...||..|:    |:.
  Fly   303 HCVVKDKMVNTDLVLRRVRLG--EHDITTNPDCDFTGNCAAPFVEIGIEYFNVHEQYFNTSRFES 365

  Fly   122 HDLALLRLAKRVHYSDNISPICLLLDPLVKNIDEHIVKFRTYGWGKTESRSSSRMLQKTSLFNLH 186
             |:||:||...|.|:..|.|||:..||    |..|....:..|||.|::|..|::|       ||
  Fly   366 -DIALVRLQTPVRYTHEILPICVPKDP----IPLHNHPLQIAGWGYTKNREYSQVL-------LH 418

  Fly   187 RSECAKQYPHQQ-----INRNHICAESANA-NTCNGDSGGPLTAIVTYDHVQMVFQFGVTSFGHA 245
            .:....:|..|.     .|.:.|||..... ::|.|||||||...:..|:..:|:..|:.|:|..
  Fly   419 NTVYENRYYCQDKISFFRNESQICASGIRGEDSCEGDSGGPLMLTLNNDYQDIVYLAGIVSYGSE 483

  Fly   246 DCS--KATVFTNVMTHLDWI 263
            :|.  |..|:|.......||
  Fly   484 NCGDRKPGVYTKTGAFFSWI 503

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG30283NP_611587.2 Tryp_SPc 42..263 CDD:214473 76/260 (29%)
Tryp_SPc 43..266 CDD:238113 78/261 (30%)
CG10232NP_651175.4 Tryp_SPc 260..506 CDD:238113 78/258 (30%)
Tryp_SPc 260..503 CDD:214473 76/256 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 102 1.000 Domainoid score I4289
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 108 1.000 Inparanoid score I3480
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
33.150

Return to query results.
Submit another query.