DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG30283 and SPE

DIOPT Version :9

Sequence 1:NP_611587.2 Gene:CG30283 / 37454 FlyBaseID:FBgn0260477 Length:273 Species:Drosophila melanogaster
Sequence 2:NP_651168.1 Gene:SPE / 42791 FlyBaseID:FBgn0039102 Length:400 Species:Drosophila melanogaster


Alignment Length:269 Identity:79/269 - (29%)
Similarity:124/269 - (46%) Gaps:55/269 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly    42 KILGGHNAPVASAPWMAMVMGEG------GFHCGGTLITNRFVLTSAHCIANGEL--------KV 92
            :|.||.|..:...|||.::..:.      .|:|||.|:.:|:|||:.||:|:.||        .|
  Fly   134 RIFGGTNTTLWEFPWMVLLQYKKLFSETYTFNCGGALLNSRYVLTAGHCLASRELDKSGAVLHSV 198

  Fly    93 RLGVLER---------------------EAEAQKFAVDAMFVHTDYYFDQ-HDLALLRLAKRVHY 135
            |||..:.                     :.|.:|..:..|:....  .|| :|:||:||.:.|.|
  Fly   199 RLGEWDTRTDPDCTTQMNGQRICAPKHIDIEVEKGIIHEMYAPNS--VDQRNDIALVRLKRIVSY 261

  Fly   136 SDNISPICLLLDPLVKNIDEHIVKFRTY-----GWGKTESRSSSRMLQKTSLFNLHRSECAKQYP 195
            :|.:.||||..|.||:|      .|..|     |||.||:...|.:..|.::...:.:.|.::|.
  Fly   262 TDYVRPICLPTDGLVQN------NFVDYGMDVAGWGLTENMQPSAIKLKITVNVWNLTSCQEKYS 320

  Fly   196 --HQQINRNHICA-ESANANTCNGDSGGPLTAIVTYDHVQMVFQFGVTSFGHADCSK---ATVFT 254
              ..:::.:.:|| .....:||.|||||||...::.....:.:..||||:|...|..   ..|:|
  Fly   321 SFKVKLDDSQMCAGGQLGVDTCGGDSGGPLMVPISTGGRDVFYIAGVTSYGTKPCGLKGWPGVYT 385

  Fly   255 NVMTHLDWI 263
            .....:|||
  Fly   386 RTGAFIDWI 394

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG30283NP_611587.2 Tryp_SPc 42..263 CDD:214473 77/267 (29%)
Tryp_SPc 43..266 CDD:238113 79/268 (29%)
SPENP_651168.1 CLIP 42..94 CDD:314844
Tryp_SPc 135..397 CDD:238113 79/268 (29%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 102 1.000 Domainoid score I4289
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.100

Return to query results.
Submit another query.