DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG30283 and CG16710

DIOPT Version :9

Sequence 1:NP_611587.2 Gene:CG30283 / 37454 FlyBaseID:FBgn0260477 Length:273 Species:Drosophila melanogaster
Sequence 2:NP_651167.3 Gene:CG16710 / 42790 FlyBaseID:FBgn0039101 Length:372 Species:Drosophila melanogaster


Alignment Length:271 Identity:85/271 - (31%)
Similarity:129/271 - (47%) Gaps:43/271 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly    33 CGTVPISQFKILGGHNAPVASAPWMAMVMGEGGFH-------------CGGTLITNRFVLTSAHC 84
            ||.: :..::|.||........||||:::..   |             |.|:|||||:|||:|||
  Fly    97 CGPI-MPAYRIFGGEETQPNELPWMALILYA---HRSRSVWNERLVSRCAGSLITNRYVLTAAHC 157

  Fly    85 IANGEL---KVRLG-------------VLERE---AEAQKFAVDAMFVHTDY-YFDQ---HDLAL 126
            :....|   :||||             :..||   .|..:..||....|..| .|::   :|:||
  Fly   158 LRITGLDLRRVRLGEHNILSNPDCVTHINGREHCAPEHLEIDVDLSIKHRHYMVFEERPYNDIAL 222

  Fly   127 LRLAKRVHYSDNISPICLLLDPLVKNIDEHIVKFRTYGWGKTESRSSSRMLQKTSLFNLHRSECA 191
            |||...|.|:..|.|||:.||.:..|......|.:..|||.:..:..|.:|.:..:...:..||:
  Fly   223 LRLKFPVRYTAQIKPICVQLDYIFSNPSFSNHKLQIAGWGLSHKQGYSNVLLQAYVNGRNADECS 287

  Fly   192 KQYPHQQINR-NHICAESANAN-TCNGDSGGPLTAIVTYDHVQMVFQFGVTSFGHADCSKA-TVF 253
            ...|...::: .||||.:...| ||.|||||||.||:.....:.|:..|:||:|::.|... ..:
  Fly   288 LSEPSLGLDKETHICAGNLGGNDTCKGDSGGPLMAIMERGDEEFVYLAGITSYGYSQCGYGPAAY 352

  Fly   254 TNVMTHLDWIV 264
            |.....::||:
  Fly   353 TKTSKFVEWIL 363

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG30283NP_611587.2 Tryp_SPc 42..263 CDD:214473 81/259 (31%)
Tryp_SPc 43..266 CDD:238113 83/261 (32%)
CG16710NP_651167.3 CLIP 35..84 CDD:288855
Tryp_SPc 105..362 CDD:214473 81/259 (31%)
Tryp_SPc 106..362 CDD:238113 81/258 (31%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.