DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG30283 and CG31199

DIOPT Version :9

Sequence 1:NP_611587.2 Gene:CG30283 / 37454 FlyBaseID:FBgn0260477 Length:273 Species:Drosophila melanogaster
Sequence 2:NP_732546.1 Gene:CG31199 / 42456 FlyBaseID:FBgn0051199 Length:293 Species:Drosophila melanogaster


Alignment Length:279 Identity:66/279 - (23%)
Similarity:99/279 - (35%) Gaps:73/279 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly     8 VVVVLLAASSVVVLGSE--SGSFLEHPCGTVPISQFKILGGHNAPVASAPWMAMVMGEGGFH--- 67
            :.|:||.   |.:.|.|  |....:..||.....|...:....|......|:|.::...||.   
  Fly     5 IAVLLLL---VGLFGPEVRSAKVNDDQCGAFDEDQMLNMQSTFAIPTEHQWVARIVYGKGFEGKI 66

  Fly    68 ----CGGTLITNRFVLTSAHCIA--NG---ELKVRLGVLEREA---------------EAQKFAV 108
                |.|.|::.|.||..|||..  ||   ...|.|||..:.|               .:|:..:
  Fly    67 RDNGCLGVLVSKRTVLAPAHCFVQYNGVAEAFSVHLGVHNKSAPVGVRVCETDGYCVRPSQEIKL 131

  Fly   109 DAMFVHTDYYFD----QHDLALLRLAKRVHYSDNISPICLLLDPLVKNIDEHIV----------- 158
            ..:.:|.||  |    ::.||:|.|.:......|:.|||:   |....::|.:|           
  Fly   132 AEIAIHPDY--DSRTLKNSLAVLTLQRDAKIYPNVMPICM---PPPSLLNETLVAQTFVVAGLRV 191

  Fly   159 --KFRTYGWGKTESRSSSRMLQKTSLFNLHRSECAKQYPHQQINRNHICAESANANTCNGDSGGP 221
              .||...|..|.||...:...|| |.....:.|..   |:|....::              |.|
  Fly   192 FEDFRLKTWVNTLSRGFCQSKVKT-LVTSSNTVCGY---HKQPVAYYL--------------GAP 238

  Fly   222 LTAIVTYDHV-QMVFQFGV 239
            |..:....|| |..:..|:
  Fly   239 LVGLQKKGHVTQNYYLVGI 257

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG30283NP_611587.2 Tryp_SPc 42..263 CDD:214473 56/243 (23%)
Tryp_SPc 43..266 CDD:238113 56/242 (23%)
CG31199NP_732546.1 Tryp_SPc 45..257 CDD:304450 55/234 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.